KEGG   Fusarium graminearum: FG08920.1Help
Entry
FG08920.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 568 aa AA seqDB search
MSSISVVVVKHQGKKHDVEIDPSSTGEDFKLQMFSLTNVEPERQKILIKGGQLKDDADMS
KLGLKPGQVIMMMGTPSAGGGELVRPKEAIKFVEDMTEAEQAQQIGATPAGLVNLGNTCY
LNSTLQTLRLIPELQDALAKYSPASGSSSNNFMMAGSNMDIASQLSNLYKKMGTTQEPFP
PLTFLGALRAVFPQFAEKSKTGQGYAQQDAEEAWSQIVQQLNQKLRITGSEDSSGKSFVE
KYMSGEFTSVLKCDEEQASTGGEKPVIATEGFSKLNCHIDSSTNHLRDGILAALEEKFEK
KSEVLDRDALYTRTSKISRAPKYLTVHFVRFFWKRETQKKAKIMRKVTFPKELDIVEFCS
DELKSALVPVRDKVREIRKDEEDIERARKRRKKTHDQDVGDIPGGAGLPTEKEKKEAEKK
QEGKSADGDTVMGEEGETYKTDADIEAERNASILAAKKELNALINPDLRNDDGANQSGLY
ELRGVITHQGASADSGHYTSYVKKAAPVDPKTGKKGEEDGKWWWFNDEKVTEVEAEKIDT
LAGGGESHSALVLLYRAIPLPSAEGVME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatttcagtagtcgtggtgaaacaccaggggaaaaagcacgatgtcgaaatc
gatcccagctctaccggcgaagacttcaagctccaaatgttcagcttgaccaatgtggag
cccgaacgccaaaagatcctcatcaagggtggccagctcaaggatgatgccgatatgagc
aagctgggcttgaagcccggccaagttattatgatgatgggtaccccgagtgctggtggt
ggtgagcttgtccgaccgaaagaggccatcaagtttgtcgaggacatgacggaagctgag
caagctcaacaaattggtgcgactcccgctggtcttgtcaacctcggaaacacatgctac
ctcaactccaccctccaaaccctgcgattgatccctgagctccaagatgccctagccaag
tacagccctgcgagtggcagcagcagcaacaacttcatgatggcaggctctaacatggac
atcgcatctcagctttcaaatctgtacaagaagatgggaacaacacaggaacccttcccc
cccttgaccttcctgggtgctctgcgagccgtgttccctcaatttgcggaaaagtccaag
acaggacaaggctacgctcagcaggatgcagaggaggcttggtctcagatcgtgcagcaa
cttaaccagaagctacgaatcactggcagtgaagactcgtccgggaaatccttcgtggag
aagtacatgtcgggtgaatttacttccgtactgaagtgcgatgaggagcaggcctccact
ggtggcgagaagcccgtcatcgccacagaaggcttttccaaactcaactgtcacatcgat
agctcaacaaaccatctccgagacggaattcttgcagcactggaggaaaagttcgagaag
aagtctgaggttctagatcgcgatgctctttacaccagaacctccaagatctcccgtgct
cccaaatacttgactgtgcattttgtgcgcttcttctggaaaagagagacgcagaagaaa
gccaagattatgcgaaaagttactttcccaaaggagctcgatattgttgagttctgttcc
gatgagctgaagagcgctctggttcctgtgcgcgacaaggttcgtgagattcgcaaggat
gaggaggatattgagcgtgctcgcaagcgtcgtaagaagacccacgaccaggacgttggc
gatatccccggcggtgctggtcttcctaccgagaaggagaagaaggaggccgagaagaag
caggagggtaagtcggctgatggagacactgttatgggtgaggagggtgagacatacaag
acggatgccgacattgaggctgaaaggaacgcctccatccttgcggccaagaaggagctg
aatgcactcatcaaccccgacttgcgcaacgacgatggcgccaaccagtctggtctttat
gagctccgcggtgtcataacacatcaaggtgccagcgccgacagtggtcactacacttct
tatgtcaaaaaggctgcccccgttgaccccaagactggtaagaagggtgaggaggatggc
aagtggtggtggttcaacgacgagaaggtaacagaagttgaagctgagaagatcgacact
cttgccggtggcggcgagtctcattctgctcttgttcttctatatcgcgccattcctctg
ccttctgccgaaggcgttatggagtaa

DBGET integrated database retrieval system