KEGG   Fusarium graminearum: FG08935.1Help
Entry
FG08935.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fgr  Fusarium graminearum
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    FG08935.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     FG08935.1
Glycosyltransferases [BR:fgr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   FG08935.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 960 aa AA seqDB search
MARTRGKSPQPPVKATTPVTEKQQPIAVPQQQQPTAVTTKSKNKNKNKVTSYQSEGVEDN
DVFLLPLSDYWVVLALMALATVVRVYKIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPP
LAKMLIALTGWLAGFDGSFDFKEIGKDYIEPGVPYVAMRMFPAICGILLIPCMFFTLKAV
GCRTMTATMGAGLIIFENGLLTQARLILLDSPLVAATAFTVLAFSCFTNQHELGPSKAFQ
LSWWFWLVLTGLGLGITVSIKWVGLFTIAWVGSLTLVQLWVLLGDNKNVSMRLFSKHFMA
RVFCLIVIPLTFYMAMFAIHFVCLQNPGDGDGFMSSEFQATLNNKRMKDVPADVMMGSRV
SIRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDDNNIWLLENQTQPLGIDGQPINGTK
AWDALPEPVHIKDGAVLRLYHSPTHRRLHSHDVRAPITEADWQNEVSAYGYEGFEGDAND
LFRVEIVKKKTRGAVAKERLRTIESKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCARG
GTLPNSLWYIEGNTHPQLQGDVEKVNYRNPGFFGKFWELQKVMWRTNAGLTDSHAWDSRP
ESWPILRRGINFWGRQHTQVYLLGNPIIWWSSSVAVAIWIVFKAIAVLRWQRSCNDYANT
TFKRFDYEIGTSVLGWALHYFPFYLMKRQLFLHHYFPALYFAVIALCQLFDYATARVPGV
GARETSVINRIATVSFLVLSAAVFTLYSPLAYGSPWTKTDCKRVKLFTTWDFDCNTFYDS
YEKYSEIPSISSSVVPTTSVAKKEEPKKEVPVVQQQEEAVISGAPPAPDQSHVEHRVVAK
EEKVEYRDQDGNLLDPEEVKALEGKVEFKTKYETKTRVVDEQGNEVQEPAEGWDQNLGAG
VAPPHPDVEGVDSETVKGNVEDAAAPQDAAASKDGEKEAEEAKAKPASENQQDATVNDEL
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacgaggggcaaaagtccccaaccgccagtcaaggccacgacgcccgtgaca
gagaaacagcagcccattgcagttcctcagcagcagcaacccactgctgtcaccaccaag
tccaagaacaagaacaagaacaaggttacatcgtaccaatccgagggtgtcgaagataac
gatgtctttcttctccccctctccgactactgggtagtcttggccctcatggcccttgct
accgtcgtccgtgtctacaagatttatcagcctacgagcgttgtcttcgatgaagtccac
tttggtggttttgctaccaagtacatcaagggcaagttcttcatggacgtccatcctcct
ctggccaagatgcttatcgctcttaccggatggcttgctggtttcgacggcagcttcgat
tttaaagagattggcaaggactatattgaacctggtgtcccctacgttgccatgcgaatg
ttccctgctatctgcggtatccttctgattccctgcatgttcttcacactcaaagctgtt
ggatgccgcactatgactgccactatgggtgcgggcctgatcatcttcgagaacggactt
cttacccaggcccgtctgattcttcttgattcccccctcgtcgccgcgaccgctttcact
gtccttgccttttcgtgcttcaccaaccagcacgaacttggtccctccaaggctttccag
ctgagctggtggttctggcttgtccttacgggtctcggtttgggtatcaccgtgagcatc
aagtgggttggactcttcaccattgcttgggttggctccctcaccctcgttcagctctgg
gttcttctcggcgacaacaagaacgtgtctatgcgtcttttcagcaagcattttatggcc
cgagtattctgtttgatcgtcattcctcttactttctacatggccatgttcgccattcac
ttcgtctgtctccagaaccctggagatggcgatggcttcatgagctccgagtttcaggcc
acccttaacaacaagcgaatgaaggatgtccccgccgatgttatgatgggtagccgtgtc
agtatccgccatgtcaacacccagggtggctacctccactctcaccctcttatgtacccc
accggcagcaagcagcagcaaattacactatatcctcacaaggatgacaacaacatctgg
cttcttgagaaccagacccaacctcttggaattgatggtcaacccattaacggtaccaag
gcctgggacgcccttcccgagcctgtccacatcaaggatggtgctgttcttcgtctttac
cacagccccacccaccgccgcctgcattcacatgacgttcgcgcccctatcactgaggcc
gactggcaaaatgaagtttccgcctatggttatgagggatttgagggtgatgccaacgat
ctcttccgagtcgagattgtcaagaaaaagactcgaggtgctgtcgccaaggagcgtctc
cgaactattgagagcaagtttcgccttgttcatgtcatgactggctgcgtcctattctct
cacaaggtcaagcttcctgattgggcttcggagcagcaggaagtcacttgcgcccggggc
ggcactctgcccaacagtttgtggtatattgagggcaacactcaccctcaactgcagggt
gatgtcgaaaaggtcaactatcgcaaccctggcttctttggcaagttctgggagcttcag
aaagtcatgtggcgtaccaatgccggccttactgactcacatgcttgggattctcgccct
gagtcctggcccatcctccgccgtggtatcaacttctggggtcgccaacacacccaggtc
tacctccttggtaaccccatcatctggtggtcttctagcgtcgctgttgccatctggatt
gtcttcaaggctattgctgttcttcgctggcagcgcagttgcaacgactacgccaacact
accttcaagcgtttcgactatgaaatcggtacttcggttcttggctgggcgctgcactac
ttccctttctacctgatgaagcgtcagctgttcctccatcactacttccccgcgttgtat
ttcgctgtcatcgctttgtgccaactctttgactacgccaccgcccgtgtccctggtgtt
ggtgctcgcgagacatctgttatcaaccgcattgccactgtctcatttcttgttctgtcg
gctgccgtcttcaccctttattctcctcttgcatatggtagcccctggaccaagactgac
tgcaagcgagtcaagctttttaccacctgggactttgactgcaataccttctacgacagc
tatgaaaagtatagcgagatcccgtcgatcagctcatctgtggtaccaacaacctcagta
gccaagaaggaagagcctaagaaggaggtccctgttgttcaacaacaggaggaagctgtc
atttctggagcccctcccgcccctgaccagtcccatgtagagcatcgtgttgttgctaag
gaggaaaaggtcgagtatcgcgaccaagatggtaacctccttgaccctgaggaggtgaag
gctctcgagggcaaggttgagttcaagaccaagtatgaaacaaagacgcgtgttgttgat
gagcagggcaatgaagtccaggagcccgctgagggttgggaccagaacctcggcgccggt
gttgccccccctcaccctgatgttgaaggcgttgacagcgagactgtcaagggcaatgtc
gaggacgctgccgctcctcaggatgctgctgccagtaaggacggcgagaaggaggctgag
gaggccaaggccaagcctgccagcgagaaccaacaggacgctaccgtcaatgatgagctt
tag

DBGET integrated database retrieval system