KEGG   Fusarium graminearum: FG09362.1Help
Entry
FG09362.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
fgr  Fusarium graminearum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    FG09362.1
Enzymes [BR:fgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     FG09362.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 527 aa AA seqDB search
MHNPTSLLVTLTAALAALPEAQAAIYTKNSPVLQLNARNYDKIIAKSNYTSIVEFYAPWC
GHCQNLKPAYEKAAKNLDGLAQVAAIDCDDDANKQLCGSMGVQGFPTLKIVRPGKKSGKP
VVEDYQGQRTAGAIQEAVMSKINNHVTRVSDKDLDSFLAGDKPKAILFTQKGTTSALIRS
IAIDFLDVISVGQIRDKEAGAVKKFGVEKFPALVLIPGEGKDHIVYDGEMAKKDMVKFLT
QAGQPNPIHASGNTKSTKGKKDDTKNTKTKKDDTKSAKKNKSTEAAKEPAAESKEPAAEP
IPSIVPISTIKSLEKLTEECLAPKSHTCVLLFTPGEAGEKAVESLSHLNTKYVHGGRNTI
PFISIPSDSDAASTLPKALGLNDKVNLIAINTRRNWWRQYSGDFSLSSVESWIDAIRMGE
GAKKKLPEGVVVEKKAGSTKATDPEPEIETDGPDDVKTVIETEIETEYETVTGADGEETR
TVVETEVEYETQTETEHAEETAEPEAQPVAESEAEPKTKDQIKHEEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcataaccccacatctctgctggtcactttgacagcagccctggcggctctgcccgaa
gctcaggctgccatttacaccaagaactctcctgttcttcagttgaatgcccgcaactat
gataagatcattgcaaagtccaactacacctctattgtcgagttctacgctccttggtgt
ggtcactgtcagaacctgaagcctgcttacgagaaagctgctaagaacctcgatggtctc
gctcaggttgctgccattgactgtgacgatgacgccaacaagcagctttgcggttccatg
ggtgtccagggctttcccactctcaagattgtccgccctggcaagaagtctggtaagccc
gtcgtagaggattaccagggccagcgaactgccggtgctatccaggaggctgttatgagc
aagatcaacaaccacgttactcgtgtgagtgataaggatcttgactctttccttgcaggt
gacaagcccaaggctattctgtttactcaaaagggaactaccagtgcgctcattcgaagc
attgccattgacttcctcgatgtaatctctgtgggccagatccgtgataaggaagcgggt
gctgtcaagaagttcggcgtcgagaagttccctgctcttgtccttatccccggtgagggc
aaggatcatattgtctacgatggtgagatggccaagaaggacatggtcaagttcctcacc
caagccggacaacctaaccctatccacgcttctggcaataccaagagcaccaagggcaag
aaggatgacaccaagaacaccaagacgaagaaggacgacaccaagagcgctaaaaagaac
aagtccaccgaagccgccaaggaacctgccgccgaatcaaaggaacccgctgctgagcct
atcccctccattgttcctatctctactatcaagagcttggagaagctcaccgaggagtgt
cttgctcccaagtcccacacctgtgtccttctcttcactcctggtgaagctggcgagaag
gctgtagagtcgctctcccaccttaacaccaagtacgtccacggaggccgcaacactatc
cctttcatctccatccccagcgacagcgacgccgcctccactctccccaaggcccttgga
ctcaacgacaaggtcaacctgattgctatcaacacccgccgcaactggtggcgccagtac
tcaggcgactttagcctttcaagcgttgagagctggattgatgccattcgcatgggcgag
ggtgccaagaagaagctccccgaaggcgttgtcgttgagaagaaggccgggtccaccaag
gccaccgaccccgaacccgagatcgagactgatggtcccgacgatgtcaagaccgttatc
gagactgagattgagaccgagtacgagactgtcaccggcgctgatggagaggagacccga
accgtcgtcgagactgaagttgagtacgagactcaaactgagactgagcacgctgaagag
actgccgagcctgaggcccagcctgtcgctgagtccgaagccgagcccaagaccaaggac
cagatcaagcacgaggagctgtaa

DBGET integrated database retrieval system