KEGG   Fusarium graminearum: FG09456.1Help
Entry
FG09456.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fgr  Fusarium graminearum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG09456.1
   01230 Biosynthesis of amino acids
    FG09456.1
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FG09456.1
   00030 Pentose phosphate pathway
    FG09456.1
   00051 Fructose and mannose metabolism
    FG09456.1
   00052 Galactose metabolism
    FG09456.1
  Energy metabolism
   00680 Methane metabolism
    FG09456.1
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FG09456.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FG09456.1
Protein phosphatases and associated proteins [BR:fgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FG09456.1
Messenger RNA biogenesis [BR:fgr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FG09456.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 783 aa AA seqDB search
MAPKKKIAVMTSGGDSPGMNAAVRAVVRMSLHMGCDAFCVYEGYEGLVQGGDFIRQMQWD
DVRGYLGEGGTLIGTARCMAFYERPGRLVAAKNMVLSGIDALIICGGDGSLTGADRFRAE
WPSLLEELISTGHLKEEQTTPYKHLNIVGLVGSIDNDLTGTDATIGCYSALARICEMVDY
VEATASSHSRAFVVEVMGRHCGWLALMAGVATGADFVFIPERPRENDWQEEMKVVVRRHR
ALGKRKTIVIVAEGARDNNGTKIGAEEIKDILADKSKGGLALDTRITTLGHVQRGGTAVA
YDRMLATLQGVEAVKAVLEATPETETPFIAINENKIVRKPLMQAVAETQELAKAVDAKDF
DKAMSLRDAEFADQWNSYMLTTNVMVDDEKLPERERMRIGFINVGAPAGGMNAAVRAAVA
YCLSKGHEPLAIHNGFAGFARHHDDKPLGAVRPFDWLEVDGWASKGGSEIGTNRELPAES
GMELIANLIEEHNFDALFIVGGFEAFHSVTQMRKARTQFPSLCIPMCLLPATISNNVPGT
EYSLGSDTCLNELVNYCDKIKQSASATRRRVFVIETQGGRSGYIATLAGLDVGASAVYIP
EEGISLEMLNSDVNHLKEVFRKDKGQTRAGRLILVNEKASKVYSAKLIADIIREEAHDRF
ESRESIPGHVQQGGVPSPMDRCRAVRLAIKCIQHLEGYGRNAHNHVKKDPKSASVIGIQG
SEVVFSGVEDLEENGTDWPNRRPKTAHWMGLSETVDMLAGRPSYPVPEKSLTGLIAKDTK
RGL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaagaagattgccgtcatgacctcgggaggtgactcccctggtatgaac
gctgctgttcgagctgtcgtgcgcatgtctctgcatatgggctgtgacgcattttgcgtc
tatgagggatatgagggtctggtccagggcggcgatttcatccgacagatgcaatgggac
gacgttcgaggctacctcggagagggtggtacacttatcggcactgctcgatgcatggcc
ttttacgagcgccccggtcgattggtagccgctaagaacatggttctatctggcattgat
gcccttattatttgcggtggtgacggatccttgactggtgctgacaggttccgagctgaa
tggccttctcttttggaggagcttatttcaacgggccacttgaaggaggaacaaaccaca
ccttacaagcatctcaacatcgtaggccttgttggctccatcgacaatgatctcacaggg
acagacgccaccattggctgctactctgcgcttgcccgtatttgcgagatggttgattac
gttgaggcgactgcttcttcacactcccgcgctttcgttgttgaggtgatgggacgacac
tgcggttggctggctctcatggccggagttgcgactggagcagactttgtctttattccc
gagagacctcgtgagaatgactggcaagaggagatgaaggtcgttgttagaagacatcga
gcactcggaaagcgcaagacaattgtcattgtcgccgagggtgcccgcgacaacaacgga
actaagattggtgccgaagaaatcaaggacatcctagccgacaagagcaagggaggtctt
gctctcgacacccgtatcaccactcttggccacgttcaacgaggtggtactgctgttgcc
tacgatcgaatgctcgctaccctacagggcgtggaagccgtcaaggctgtccttgaagct
acccccgagaccgagactccctttatcgccattaacgaaaacaagattgttcgcaagcct
ctgatgcaagctgttgccgagacacaggaactcgccaaggctgttgacgccaaggatttc
gacaaggctatgtctctacgagatgctgagtttgccgatcaatggaactcttatatgttg
acaaccaacgtcatggtcgatgacgagaagttgccggagagagaacgcatgcgaatcggt
ttcatcaacgtcggtgcccctgctggtggcatgaacgccgcagttcgtgcggctgtcgca
tactgtctttcaaagggtcacgaacctcttgctattcacaacggttttgcaggatttgct
cgacaccacgacgataagcccctcggtgcagttcgcccgttcgactggctcgaggttgat
ggctgggcaagcaagggtggttccgagattggcacaaacagagaacttcctgccgagtca
ggcatggaactgattgccaacttgattgaggagcacaactttgatgctttgttcatcgtt
ggtggcttcgaggctttccactccgtcacacagatgcgcaaggctaggacgcaattcccc
tctctgtgcatccccatgtgccttctccctgccacaatctccaacaacgttcctggaaca
gaatactctctgggatccgatacctgcttgaacgaacttgtcaactactgtgacaagatc
aagcaatctgcttctgccacgcgtcgtcgtgtgtttgttattgagacgcagggaggccga
tctggttacattgctaccttggccggtctcgacgtcggtgcttcggctgtctacatccct
gaagagggtatttcactcgagatgctcaattctgatgtcaaccatctcaaggaagtgttc
cgaaaggacaagggtcagactcgtgctggacgcctaattctcgtcaacgagaaggccagc
aaggtctacagcgcaaagctgatcgccgacatcatccgcgaggaggctcacgatagattc
gagagccgagagagcatccccggtcacgtccagcagggtggtgttccttcccctatggat
cgctgccgagctgttcgcctggccatcaagtgtatccagcacctcgaaggttatggacgc
aatgcccacaaccacgtcaagaaggaccccaagagtgcctcagtcattggcattcaggga
tccgaggttgtattctccggagtggaagatctcgaggagaacggcacagactggcccaac
cgacgacccaagactgcccactggatgggtctttctgagacagtggacatgttggcgggc
cgtcccagttaccctgtgcccgagaagagcttgacgggcttgattgcaaaggacacaaaa
cgtggtctttaa

DBGET integrated database retrieval system