KEGG   Fusarium graminearum: FG09539.1Help
Entry
FG09539.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
fgr  Fusarium graminearum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FG09539.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     FG09539.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 790 aa AA seqDB search
MSAEPSPATNGSPAQQQQQPQPPPLRSALKSEEDIERPLPPSGSLKVQIAEPESEIQTLE
DDSQPTKQFHTNLRRRLSGKLPPSQLPNSSSRSSLSDSPSTSRAPEEPAPTSNPSSHHHH
SHRRQYYSEKLLAQVGDWLEHERAKAHARKSKKTSRRRKSKSPNKENQSKSTGESEPATA
STSAQGSEQSNNGRPRSDSVDSDSSDTSFDRLQRILEESLAHMGLNGLPHMAPKMARPKQ
RKVPSRSSLLGPSSDTEYADGDAIVPSCDVWLDNTKTMSYAGGNADAEDQDINDTDIKAD
KGKECWLSFKNEIIRIAHTLRLKGWRRIPLGGGDSISVVRLSGALTNAVYVVTPPKEIDE
TDGKRKPTKVLLRIYGPQVEHLIDRDNELSVLQRLARKKIGPRLLGTFQNGRFEQYFESI
TLTPMDLRDPDTSRSIAKRMRELHEGIDLLPHEREGGPATWKSWDQWLDNVERIATYLDN
EYEKHVEGQHGQQDSVAHAWKSRGYVCGTTWPEFRNMMTKYRVHLNSFYKGGQREVKDSL
VFAHSDTQYGNILRIRPDDEKSPLLQAANKHKQLIVIDFEYAGPNTRGLEFANHFNEWTY
NYHDAAAPWACDVRRYPTPDEQRRFIKAYVDHRPRFQGSNSTPRLAPVDSNASSGMSTPL
ATPGNPAANSSSSIVEFMLDARVPPGGWSAAERANDEQRDQRVRELLEETRQWRPANHAH
WIAWGLVQAKIPGLDESIKEEDLLSPDEFDYLSYAQDRTMFFWGDCVRMGLVKLEQLPPK
LQQQVKTAEY
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgagccgagccccgcgacaaacggctcgcctgctcagcaacagcagcagcct
cagcctcccccgttacgttcagccctcaagagtgaagaggacattgaacgtccacttccc
ccaagcggttcgcttaaagtccagattgctgaacctgagtctgagatccagacactcgag
gatgactcccagcctacaaagcaatttcataccaacctccgacggcgcctaagcggcaag
cttccaccttctcaacttcccaacagctcttccaggtcctccttgagcgacagcccttcc
accagtcgcgcgcccgaagaacctgctccgacttcgaacccctcttcgcaccaccatcac
agtcaccgccgtcagtattatagtgagaaactgcttgcccaggtgggggattggttggaa
catgagcgtgccaaagcacatgctaggaaatcaaagaagacgagccgccgccgcaagtcc
aagtcgcccaacaaggagaatcagtccaagagcactggagaaagtgagcctgcaaccgcc
tcaacatccgcgcaaggatccgaacagagcaacaatgggcgtccccgctctgattctgtc
gactctgactccagtgatacctcttttgataggctccagcgtatcttggaagagtctcta
gcgcatatgggccttaatggactgcctcacatggcccctaagatggcccgaccaaagcag
cgaaaggttccttctcgatcttctctgcttggcccttcttccgataccgaatatgctgat
ggtgatgccattgtgcctagctgtgatgtttggcttgataacaccaagacaatgagctac
gctggtggcaatgcagatgctgaagatcaggacatcaacgacactgatatcaaggccgac
aaagggaaagagtgctggctcagcttcaagaacgaaattattcgcatcgctcacactttg
aggctcaagggatggaggcgtatcccactaggtggtggtgacagcatttctgtcgtgagg
ttgagcggtgccctgaccaatgctgtctacgtcgtcacgcctcccaaggaaattgatgag
accgatggcaagcgaaagcctaccaaggtcctgctacgcatctacgggcctcaggtcgag
cacctcattgatcgagacaatgaactctcagttttgcaaaggttggcgcgcaagaaaatt
ggacccagattgcttggtactttccaaaatggccgattcgagcagtacttcgaatctatc
acgcttactccaatggacctccgagacccggacacgtctcgctcgattgccaagcgaatg
cgagagcttcacgaaggcattgatctgcttccccacgagagggaaggtggccctgccaca
tggaagagctgggatcaatggttggacaacgtagagcggatcgccacttatctcgacaac
gagtatgaaaagcacgttgaaggtcagcacggccagcaggactctgttgctcatgcttgg
aagtcgcgaggctatgtgtgcggaaccacttggcctgaattcagaaacatgatgacgaag
taccgagttcatctcaacagcttctacaaaggaggccagagagaggtcaaagacagcctc
gtatttgcgcacagtgatactcaatatggaaacattcttcgcattcgccctgatgacgaa
aagtcaccacttcttcaggctgccaacaagcataaacagcttatcgtcattgactttgaa
tatgcgggacccaacacccgtggtcttgaatttgccaatcacttcaacgagtggacgtac
aactaccatgatgctgcggcgccctgggcgtgcgacgtgcggcgatatcccacacctgat
gaacagcgtcgctttattaaggcttatgtcgatcaccgtccccggttccaaggcagcaac
tccacaccccgactggctcccgttgatagtaacgcctccagcggcatgtcaacgccactt
gcgacacctggaaaccctgctgctaacagctcaagctccattgtcgagttcatgcttgat
gcgcgagtgcccccaggaggttggagcgctgcggaacgagccaacgacgaacagagagac
cagcgcgtgcgagaactgttggaggagacccgacagtggcgccccgccaatcacgcccac
tggattgcgtggggccttgtccaagccaagatcccaggtctcgatgagtctatcaaagaa
gaagacttgctgagccctgatgagttcgattacttgagttatgcacaagaccgcaccatg
ttcttctggggcgactgcgtgcgcatgggacttgtcaaactggaacagctgccacctaag
ctgcagcagcaggtcaagactgccgaatactaa

DBGET integrated database retrieval system