KEGG   Fusarium graminearum: FG09612.1Help
Entry
FG09612.1         CDS       T01038                                 

Definition
similar to AF184980_1 osmotic sensitivity MAP Kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
fgr  Fusarium graminearum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    FG09612.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     FG09612.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   FG09612.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 370 aa AA seqDB search
MAEFVRAQIFGTTFEITSSPPFIAILTRLARRYSDLQPVGMGAFGLVCSARDQLTNQNVA
VKKIMKPFSTPVLAKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRL
LTSRPLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQD
PQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIIT
ELLGTPPDDVINTIASENTLRFVKSLPKRERQPLRNKFKNADDSAIDLLERMLVFDPKKR
ITATEALAHDYLSPYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEAGV
TNMEEQFNGQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtttgtacgcgcccagatcttcggaaccacgttcgagattacctcgagccct
ccattcatcgcaatactgactcgtcttgcgcgcagatactccgatctccagcccgttggc
atgggagcttttggtctcgtatgctctgctcgagatcagctcaccaaccaaaatgtcgcc
gtcaagaagatcatgaagcctttcagcacacctgtgcttgccaagcgcacataccgtgag
ctcaagctgctcaagcatcttaagcacgaaaacgttatttctctcagtgacatcttcatc
tcacccttggaagatatttatttcgtcacagaactcctcggtaccgatctccaccgatta
ttgacttcgcgccctctcgaaaagcagttcattcagtatttcctctaccagatcatgcgt
ggactcaagtacgtgcattcggccggtgttgtccaccgtgacctcaagcctagcaacatt
ctcgtcaacgaaaactgcgatttgaagatctgcgactttggtcttgcccgaatccaggac
ccccagatgactggctatgtttctacacgatactaccgagctcccgagattatgctcacc
tggcaaaaatacgacgttgaagttgatatctggagtgctggctgcattttcgctgagatg
cttgagggcaagcctcttttccctggaaaggatcacgtcaaccaattctccatcatcacc
gagctcctcggcaccccccctgatgatgttatcaacaccatcgccagtgagaacactctt
cggtttgtcaagtcgctacccaagcgcgagagacagcccctccgtaacaagttcaagaac
gcagacgactcagccattgaccttctcgaacgcatgcttgtctttgaccccaagaagcga
ataactgccactgaggctctcgctcacgactacctttctccctaccatgaccctacagac
gagcctgtggctgaggaaaaattcgactggagtttcaacgacgccgatctgcctgttgat
acatggaagatcatgatgtactcggaaattctcgactatcataatgttgaagccggtgtc
accaacatggaagagcagtttaatggacaatag

DBGET integrated database retrieval system