KEGG   Fusarium graminearum: FG09724.1Help
Entry
FG09724.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
fgr  Fusarium graminearum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FG09724.1
   03420 Nucleotide excision repair
    FG09724.1
   03430 Mismatch repair
    FG09724.1
   03440 Homologous recombination
    FG09724.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 275 aa AA seqDB search
MSAYSGFTKTSYGAQGGDDSGGFFAGGSQQGSQGGGGKAYQDESLRPVTIKQILDAEEAY
AGADFKIDGSPVTQITFIGQVRSVQPQPTNITLKIDDGTGQIEVKKWIDVDKADDSEAGF
ELDSHIRIWGRLKSFNNKRHVGAHVIRPVSDFNEVNYHMLEATYVHLYFTKGPLGGQGGG
ANGDDGMFVDGGGYNDNAGGNTNSHSKLAGCSPLAKKMFKFMSDQPGGNEGVHVNIITSS
TGMSVRDALTASDELLGQGLIYTTVDDETWAVLEY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttactctggattcacaaaaacaagttacggtgcccaagggggcgatgactct
ggaggtttcttcgctggtggttctcagcaaggcagccaaggtggtggtggaaaggcatac
caggatgagtccttgcgccccgtcaccattaagcagattctcgacgccgaagaggcctat
gccggcgccgacttcaagatcgatggttcccccgtgacccaaatcacattcatcggacaa
gttcgcagcgtccaaccccagcctacaaatatcaccctcaagatcgatgacggtaccggc
cagatcgaggtcaagaagtggattgatgtcgacaaggcggacgactccgaagccggtttc
gagctcgactctcacattcgcatctggggtcgtctcaagtccttcaacaacaaacgccat
gttggtgcgcatgtcatcaggcccgtctcagatttcaatgaggtcaactaccacatgctc
gaggccacatacgttcatctttacttcaccaaaggacctctcggtggtcagggtgggggc
gccaacggagatgatggtatgtttgtggatggtggtggttacaatgacaacgccggtggc
aacaccaactcgcactccaagctcgctggttgcagtccactagccaagaagatgttcaag
tttatgagcgatcaaccgggtggcaacgagggagttcacgttaacatcattaccagctcg
actggcatgtcagtacgggacgctctcacggcctctgatgaattgctcggtcagggtctt
atctacacgacagtcgatgacgagacttgggcagttctggagtactaa

DBGET integrated database retrieval system