KEGG   Fusarium graminearum: FG09786.1Help
Entry
FG09786.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     FG09786.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 689 aa AA seqDB search
MAELDTLDVIVLGVIFLGTVAYFTKGKLWGVTKDPYANGFAAGGAAKPGRTRNIVEAMEE
SGKNCVIFYGSQTGTAEDYASRLAKEGKSRFGLNTMIADIEDYDFDSLDTVPNDNVVMFV
LATYGEGEPTDNAVDFYEFITGEDATFNEGNDPPLGNLNYVAFGLGNNTYEHYNAMVRKV
DQALEKFGAHRIGEAGEGDDGAGTMEEDFLAWKDPMWESLAKKMGLEEREAVYEPIFAIN
ERDDLSPESNEVYLGEPNKLHLEGTAKGPFNSHNPYIAPIAESYELFSAKDRNCLHMEVD
ISGSNLKYETGDHIAIWPTNPGEEVNRFLDILDLSGKQHSVITVKALEPTAKVPFPNPTT
YDAILRYHLEICAPVSRQFVSTLAAFAPNDSIKAEMNRLGSDKDYFHEKTGPHYYNIARF
LSSVSKGEKWTTIPFSAFIEGLTKLQPRYYSISSSSLVQPKKISITAVVESQQIPGRDDP
FRGVATNYLFALKQKQNGDPSPAPFGQTYELTGPRNKYDGIHVPVHVRHSNFKLPSDPGK
PVIMIGPGTGVAPFRGFVQERAKLARDGVEVGKTLLFFGCRKPSEDFMYEKEWQEYKEAL
GDKFEMITAFSRESAKKVYVQHRLKERAQEVSDLLSQKAYFYVCGDASNMAREVNTVLAQ
IIAEGRGVSEAKGEEIVKNMRSANQYQWW
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactagacactctggacgttatcgtcctcggagtcattttccttggaacggtc
gcatacttcacaaaaggaaagctatggggtgttaccaaggacccttatgccaatggcttc
gctgccggcggcgctgccaagcctggtcgcacgagaaacatcgtcgaggccatggaggaa
tctggcaagaactgtgtcatcttctatggttctcagactggtaccgctgaagattatgct
tcccgtctcgccaaggagggtaagagtcgattcggactcaacaccatgatcgccgatatt
gaagactacgatttcgatagcctggatactgtccccaacgacaacgttgtcatgtttgtc
ctcgcaacttacggtgaaggcgagcctaccgacaacgcagtcgatttctacgagttcatc
actggtgaggatgccaccttcaacgagggcaatgacccccctctgggcaacctcaactat
gtcgctttcggtctcggaaacaacacctacgaacactacaacgccatggtccgtaaagtt
gaccaggctcttgagaaatttggtgctcaccgcatcggcgaagctggtgaaggtgacgat
ggcgctggtaccatggaagaggacttcttggcctggaaggatcccatgtgggagtccctt
gctaagaaaatgggactggaagagcgcgaagccgtttacgagcctatctttgccattaac
gagcgtgacgacctgagccccgaatccaacgaagtctatctcggtgaacctaacaagctg
catctcgaaggcactgccaagggtccctttaactctcacaacccctacattgcccctatt
gccgagtcatacgagctcttctctgccaaggacaggaactgccttcacatggaagtcgac
atcagcggttctaacctcaaatacgaaactggtgatcacattgctatctggcccacaaat
cctggtgaggaggttaaccgtttcttggatattctcgatctctccggcaagcagcacagc
gtcatcaccgttaaggctcttgagcctaccgccaaggttcccttccctaaccctacgacc
tacgatgccattctgcgataccatctcgagatctgcgctcctgtttcccgtcaattcgtt
tctactctcgctgctttcgctcccaacgactctatcaaggctgagatgaaccgtctcggt
agcgataaggactacttccacgagaagaccggccctcactactacaatattgctcgtttc
ctctccagtgttagcaagggtgaaaagtggaccacgattcccttctccgccttcatcgag
ggtctcaccaagctccagccccgctattactccatctcctcctcttctctggttcagcct
aagaagatttccatcaccgccgtcgtcgagtcccagcaaattcctggccgagatgaccct
ttccgcggcgtcgctaccaactatctctttgccctgaagcagaagcagaacggcgacccc
agcccagcaccttttggtcagacatacgagcttacaggtccccgcaacaagtacgatggt
atccatgtccccgtccatgttcgtcactccaacttcaagctaccttcggaccctggaaag
cctgtcatcatgattggccctggtactggtgtcgctcctttccgtggtttcgtccaggaa
cgtgccaagttggcccgcgatggtgttgaggtcggaaagactctattgttcttcggttgc
cgaaagcccagtgaagatttcatgtacgagaaggaatggcaggaatacaaggaggctctc
ggcgacaagttcgagatgatcacagccttttctcgagaaagcgccaagaaggtttatgtt
cagcaccgacttaaggagagagcacaagaggtcagcgacctgctctcccagaaggcctac
ttctatgtttgtggtgatgcttcaaacatggctcgcgaggtcaacactgttttggcgcaa
atcattgccgaaggacgtggagtgtctgaggctaagggtgaggagattgtgaagaacatg
agatcggcaaaccaatatcagtggtggtga

DBGET integrated database retrieval system