KEGG   Fusarium graminearum: FG09896.1Help
Entry
FG09896.1         CDS       T01038                                 

Definition
ACEA_NEUCR Isocitrate lyase (Isocitrase) (Isocitratase) (ICL)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FG09896.1
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FG09896.1
Enzymes [BR:fgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     FG09896.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 546 aa AA seqDB search
MASQNMTNPSINPDIEDELFQKEVEAVKTWWSDSRWRQTKRPFTAEQIVSKRGYLPIDYA
SNTQAKKLWKILEHRFENRDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASASDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKEQRANLLNIDYLRPIVADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRAQA
DIMGSDLLAIARTDAEAATLLSTNIDPRDHAFILGSTNSTLKPLNDLMIAAEATGKSGAE
LQRIEDEWLAKANLSSFDDAVAAAIDAGSFSDKAGIKQEYTSRAKGKSNFEARAVARQLL
GRDIFFDWDAPRTREGYFRLKGGCDCAVNRAIAYAPYCDAIWMESKLPDFAQAEQFAQGV
HAVWPEKKLAYNLSPSFNWKTAMPRDEQETYIRRLAKLGYCWQFITLAGLHTTALISDQF
AKAYSTVGMRAYGELVQEPEMDQKVDVVKHQKWSGATYVDELQKMVTGGISSTAAMGAGV
TEDQFK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacaaaatatgacaaacccttctattaaccccgatattgaagatgagctcttc
caaaaggaggttgaggctgtcaagacatggtggtctgattcaagatggcgacaaaccaag
cgaccgtttaccgctgagcagatcgtttcgaagcgcggataccttcctattgattatgct
agcaacacccaggccaagaagctatggaagattcttgagcaccgttttgagaatcgcgat
gctagctacacctacggctgtttggaacccacaatggtgacccaaatggctaaatatctc
gatacggtctatgtttctggctggcagtcatcgtcgacagcctctgcttccgacgagcct
ggccctgatctggctgactacccttatactaccgtccctaacaaggttggccatctcttc
atggcccaacttttccacgatcgaaagcagcgtcaagagcgtctcagcgtccctaaggag
cagcgcgccaacctcctcaacattgattatctccgccccattgtcgcagacgcagatact
ggtcatggcggtctcaccgctgtcatgaagctcaccaagctcttcattgaaaagggtgcg
gccggaattcacattgaagaccaagcccccggcacaaagaagtgcggccatatggccggt
aaagtccttgtccccattcaagaacatatcaaccgcctcgttgcaatccgagcgcaggct
gacatcatgggctctgaccttctcgctattgcccgtactgacgccgaggctgccacactc
ctttccaccaacattgacccccgcgaccatgcttttatcctcggctccacgaactctaca
ctcaagcccctcaacgatctgatgatcgccgctgaagctactggcaagtctggtgctgag
ctgcagcgtattgaggacgagtggcttgccaaggccaatctcagcagtttcgacgatgct
gtcgctgctgccattgacgcgggttccttctctgataaggctggcatcaagcaagaatac
acttccagggcaaagggaaagagtaactttgaggccagggctgttgctcgccagcttctc
ggcagggatatcttctttgattgggatgctccccgaacgcgtgagggttacttccgcctc
aagggtggatgtgactgcgcagtgaaccgcgctatcgcctatgcaccttactgcgacgcc
atttggatggagtccaagctgcccgatttcgctcaagccgaacagttcgctcaaggtgtc
cacgctgtctggccagagaagaaactcgcttacaacctgtctccctcgttcaactggaag
acggccatgcctcgtgatgaacaggagacttacatccgacgtctggctaagcttggttac
tgctggcagtttatcactcttgcgggcttgcacacaacagcattgattagtgaccagttc
gcaaaggcttacagcaccgtcggcatgcgtgcctatggcgagcttgtccaagagcccgag
atggaccaaaaagtcgacgttgtcaagcaccagaagtggagtggtgctacctacgtcgac
gagttgcagaagatggtcacaggtggtatcagttccacggctgctatgggcgccggtgtg
actgaagaccagttcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system