KEGG   Fusarium graminearum: FG09903.1Help
Entry
FG09903.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
fgr  Fusarium graminearum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:fgr04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 518 aa AA seqDB search
MSDPFAPRSMKRKNVKGLALKAAAPRPPPTAETSNHEYSGSQDAGRDEQLEIGIEYKLDL
RPEDLEILKELGSGNGGTVSKVKHITTGTVMARKVIHVEAKREIRKRIVRELQIMHGCHS
DYIVTFYGAFLTPNNDVIMCMEYMDVGALDRVSRVFGPVRVDVLGKIAEATLGGLTYLYT
KHHIMHRDIKPSNILVNSRGGIKLCDFGVSGELVNSIADTFVGTSTYMAPERIQGEKYTV
KSDVWSFGLSIMELAIGKFPFAASEQVSDGDFAPAGILDLLQQIVHEPAPKLPKSDAFPS
ILDDMIQKCLYKEPERRPTPQELFDRDHFVQAAKRTPVDLREWAVGMMERDNRKSHLAPQ
LSPSTQDLLRSSDSPTQSQQAQAQAQAQPEERSHTPTSGEIPIGGAGITSPRDQYGSNQN
RSPPRNGHASSRTPASAHPGLGSRVITTNSIPKVSGYPDNVGPVSANAATFSLPVRPAPP
GGPLPPPPPRKETPDELRRENRRQATFGLPPNPSYGIQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctttcgctccgcgctctatgaagcgcaagaacgtcaaaggtcttgctctg
aaagcagccgctccacgacccccaccaaccgctgagaccagcaatcatgaatacagtgga
agccaggacgctggcagggatgagcagctggaaattggtattgaatacaagctagatctg
cgacctgaggatcttgaaatcctcaaggaattaggatccggaaatggtggaactgtcagc
aaagtcaagcatattactaccgggactgtcatggctcgcaaggtaattcatgttgaagct
aagcgagagatacggaagcgaatcgtccgagagcttcaaatcatgcacgggtgccattca
gactatatcgtgacattctacggcgccttcctaacccccaacaacgatgtgatcatgtgt
atggagtatatggatgttggtgctctcgaccgagtctccagggtctttgggcctgtccgg
gttgatgtcttgggcaagatcgccgaagccactttgggcggcttgacctatctctacaca
aagcatcacatcatgcatcgtgatatcaagccttctaacatcctggtaaactcaaggggc
ggaattaaactttgtgacttcggtgtctcaggcgagcttgtcaattccattgccgacacc
ttcgtcggaacttccacctacatggcccctgaaagaatccagggtgaaaagtacacggtt
aagtcagacgtctggagttttggtcttagtatcatggagcttgccattggcaagtttcct
tttgcagccagcgagcaggtatcggatggcgattttgcccctgcgggtatcctggacttg
ttgcaacagatcgttcacgaaccagctccaaagcttcccaagagcgatgctttccctagt
atcctcgacgacatgatccagaagtgtctttacaaggagcccgaacgtcgacctactcct
caagagctctttgaccgcgatcactttgtgcaggctgccaagcgtacaccagtcgatctt
agggaatgggctgttggcatgatggaacgcgacaacaggaaatcgcatctcgcccctcag
ctctctccttcaacgcaggacctccttcgatcaagcgattctcctacccaatctcagcag
gctcaagcccaggcacaagctcaacccgaagagcgttcacacactcccacttcaggcgag
attcccattggcggtgccggtatcacctcccctcgcgaccaatacggctcaaaccagaac
cgatcacctcctcgaaacggacatgcatcttcccgaacgccggcttcagcacatcctgga
ctgggatctagggttattaccacaaattccatccccaaggtttcgggttaccccgataac
gtcggcccagtgagtgcaaacgctgcaacttttagtttgcccgttcggccggcaccccca
ggcggccctttgccgccacctccaccccgaaaagaaactcctgatgagttgcgaagagag
aataggagacaagctacgtttgggctgccacccaacccaagctacggcatacagtga

DBGET integrated database retrieval system