KEGG   Fusarium graminearum: FG10080.1Help
Entry
FG10080.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fgr  Fusarium graminearum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FG10080.1
Enzymes [BR:fgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FG10080.1
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FG10080.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 386 aa AA seqDB search
MSFSSLVQDLSLRDANGARRPQISGPRSSASTLDDRASHISRAMSYASTAATSVSISGDI
SSQLHGGYFHPLARSWQAERQLTKSMLIYPLFVTDGEGDMILVPSLPGQHQLSCDKLIPF
LEPLVHKGLRSVMLFGVPMQAGTKDALGTAADDPEGPVIRAIQIIRRRFPQLFICCDVCL
CEYTSHGHCGILRDDGSLNNQLSVDRISDVAIAYAKAGAQCVAPSDMNDGRIRAIKLKLI
EEGIAHKTVLMSYSAKFSGCLYGPFRDAAGSAPSFGDRKCYQLPPGGRGLARRAIVRDIN
EGADIIMVKPASQYLDIISDAKDLGKDLPVAAYQVSGEYAMIHAGAKAGVFDLKAMAFES
TEGILRAGATIVVSYFTPDFLDWLEN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctccagccttgttcaggacttaagcctccgcgacgccaatggtgctcgccgc
ccccagatttccggtccccgctcgtccgcttccactctcgacgacagagcctcgcacatc
tcgagggccatgtcctacgccagtaccgctgccaccagcgtcagcatctccggcgacatt
tcaagccagctccatggtggatactttcaccctctggctcgctcatggcaggctgagcgt
cagctcaccaagtctatgcttatctaccccctctttgtcaccgacggtgagggcgacatg
atcctcgtcccttctctccctggtcaacaccagctcagctgcgacaagctgattccgttc
ctcgagcctctcgtccacaagggtctccgttccgtcatgctctttggtgttcccatgcaa
gctggcaccaaggatgctcttggcactgccgccgacgaccccgaaggtcccgttatccga
gccattcaaatcatccgccgccgattccctcaacttttcatttgctgcgatgtctgtctt
tgcgagtacacctcgcacggccactgcggtatcctccgcgatgatggcagtctcaacaac
cagctatccgttgaccgcatctccgatgttgccatcgcttacgctaaggccggcgctcaa
tgtgttgctccctcagatatgaacgatggccgtattcgtgctatcaagctgaagctgatt
gaagagggaattgcccacaagactgttctcatgtcctactctgccaagttctctggttgt
ctgtacggtcccttccgcgatgctgctggctcagcgccttcatttggtgaccgtaagtgc
taccagcttccccctggtggccgcggtcttgctcgacgtgctattgttcgagatatcaac
gagggagccgatatcatcatggtgaagcctgccagccagtacctcgacattatcagtgac
gccaaggacttgggcaaggatctgcccgtagccgcataccaggtcagcggcgagtacgcc
atgatccacgccggagccaaggccggcgtctttgacctgaaggcaatggcctttgagtcg
acagagggaatcttgcgagctggtgctaccatcgtagtcagctactttacccctgacttc
cttgactggctggagaactaa

DBGET integrated database retrieval system