KEGG   Fusarium graminearum: FG10095.1Help
Entry
FG10095.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
fgr  Fusarium graminearum
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    FG10095.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     FG10095.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   FG10095.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1399 aa AA seqDB search
MSREHKAPAGPRPANFSPTRLGKTTNPQPRPPLPSTNPGFASDDPMLSATPSSNHSLFSS
FSRDGEQNQLNDSTASFDFLPSVSFDDLHSSIESASTDFKLAQFPSSTGEGGSLDAHGAD
DSSMSSRSQIAPSSNGAANRPAVQSSTRPARSSSILRRPSNSIRQPNNTTGVSVQTEIAT
GPGTARSRRQSQYPPVSGTTVAKPPRKSIGPGIIGDGDYGSRPAQKRRPSLYSEGAPTGS
ARVSMDANPSWLENTTRNFSTSRATKAKSVQPPPRSNQANLGFGNTLTPEQNRHSTLAPR
SPRVGGRLSTPSSTNKRVSMMPGAHHSSHATGLGARTISPTDTRRMKRMSTMPQSVSLGQ
VSTPPPPPPVSMNNQVERAESKSPSMIPRRTSGTPSSSRTTPDMHRKSYNSVLSATSCLS
INSARTSTGSLNRISASSSTSRLPAPKHTTVHNPIPTDDDEYVPPVPAIPKAYESPKDSP
ADTYFMEKKKTALSNMDAMGANSNPTGVISMPVFPEPTKLHRKPSGQRSYVPMVAAEPDN
KATPPNKRHLQPLRLPPMNLGPLSTPTTNKIAALQDHNSVDRHETPPPPRHLPKTPTTPM
TASKSSFFAKTRRGDTPELPSLRSSSSVHHAHFTPTPPDVSSTESSLAYKELDHKQSMSP
FLSSSLPKGGADHGFLKRSKTGADFTTSDASIFQDQPHHKPAGPRAPKDAESTSSKSPPP
EPTPEEPQTPSSMSSIRRKLSLSWKRGNSKNNTTAAGDVPDKTHAKQPEEPMPPPRIPIS
ATLNNLSSVKQASPSPNMKQGPSGYLDTRRRKSSGGSLNGLITHDKTKSDSWTAKKPVPD
PSTMPVGRNTSVMQKILRPRNSSGLAKGPDSYSADLDKDDQAAEEEMAKLGSRRKETDVA
ARTLDALKKRATPKERVGAHEAIRIAMLNIYERGEIVDYTDVFFCGTQNAHKVVGDLQSD
APNFGYDDERGDYTIVPGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTGGLVAIKIIRNKK
RFHQQALVEVNILQKLREWDPKNKHSMVNFTQSFYFRGHLCISTELLDMNLYELIKAHAF
RGFSIRIIRRFTKQILSSLNLLKQHKVIHCDLKPENILLRHPLHAEIKVIDFGSSCFENE
KVYTYIQSRFYRSPEVILGMTYGMPIDMWSVGCILAELYTGVPIFPGENEQEQLACIMEV
FGPPEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSSKTLSQVLKCDDEVFLDFLQR
CLRWDPERRLKPEDAIRHEFITGRKMPLPRMPPTRESSPMKRHNTISTPRPLPDPPGSAV
KPLGSLRSGASPHKPVSGPVRKASGQMGPVSSMPTKRTSAGTTGLAQGASGLPRAAGRTV
SGKQDLAAAGATAAMSRRS
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgagcacaaggcacctgctgggcctcgaccagccaacttttctccaacgcga
ctgggcaaaaccacaaaccctcagcctcgaccacctctaccctcgacgaatcctggcttc
gcctctgacgatccaatgctcagcgcaactccttccagtaaccattctcttttttcttct
tttagtagggatggggaacaaaatcaattaaacgattcgactgcgtctttcgactttttg
ccgtcggtcagctttgacgatctgcatagcagtatcgagtcggcttcaacagacttcaaa
ctcgcccaattcccgtcctccaccggtgaagggggtagtctcgatgcccacggagcagat
gatagcagcatgtcttctcgttctcaaatagctccatcttcgaatggtgctgccaatcgc
cctgccgtccaatccagcactcgacccgcccgatcaagttcgatcctgcgccgacccagt
aactctatcaggcagcctaacaacaccaccggtgtgtctgttcagactgaaattgcaacc
gggccaggcactgcacgctctcgccgacagagtcaatatcctcctgtatctggcactacc
gtggccaagcctccccggaaatcaatcggccccggaatcattggtgatggagattatggg
tctcgtcctgcccaaaagaggcggcccagtctgtattctgaaggagcacctactggctct
gccagggtttcgatggatgccaatccgtcatggctagaaaatacgacaagaaacttttcc
acttcgagggccaccaaggctaaatcagtgcagccgccaccacgttcgaatcaagcaaac
ttgggtttcggcaatacccttactccggagcagaacaggcattcaactcttgccccgcga
tcgcctcgtgtaggaggccgactgagcacgccgtcatctaccaacaagagggtctccatg
atgcccggtgcccaccactcgtcgcacgcgacaggccttggggcaaggacaattagtcct
actgatacaagacgaatgaagcgtatgtccacgatgccacaatccgtgagccttggccag
gtgtcaacacctccgccgccgccgccagtgtcgatgaacaaccaggtagagagggccgaa
tcgaaatcaccttcgatgataccaaggaggacttctggtactccatcatcctcacgaact
accccggatatgcatcgcaagtcttataactctgtcttgtcagccacttcttgcttgagc
ataaattctgcaaggacgtcgacagggtccctgaatcgtatatctgcctcgtcatctacg
tcacgcctgcctgcaccaaaacacactacagtacacaaccctataccaaccgatgatgat
gaatatgtgcctcctgtccctgctataccaaaggcatacgagtccccgaaggactcgcct
gcggatacctacttcatggaaaagaagaagactgcgctcagcaacatggatgccatgggt
gccaattcgaacccaaccggcgtaatatcgatgcctgtctttcccgagcctacaaagttg
cataggaagccaagtggtcaacggagctatgtaccgatggtggccgctgagcccgacaac
aaggccacaccccctaacaagcgacatctgcagccactacgactacctccaatgaatctc
ggaccgttgagcacgccaacaactaacaaaattgcagccctgcaagatcacaatagtgtg
gacagacatgaaacccctccaccaccgcgacatttaccgaagacaccaactactccgatg
acagcttccaagagctctttctttgccaagactcgtcgcggggatactcctgagctccca
tctctgaggagcagcagttctgtccaccatgcccacttcactcctacacctcccgatgtc
agttcgaccgagtcctcgttggcttacaaggagcttgaccacaagcaaagcatgtcgcct
ttcttatcgtcctctctgcccaagggaggtgcagatcacggtttcttgaagcgatctaaa
acgggtgctgacttcacgacatcggacgccagcatcttccaagatcaacctcaccataag
cccgcaggcccacgagcaccgaaagacgccgaatccaccagctccaagtccccacccccc
gagcctacaccagaagaaccgcaaacgccgtcttctatgagctctattcgacgaaaactt
agcctctcctggaagcgtggaaattccaagaataacacaaccgccgctggagatgttcct
gataagacacatgcaaagcagccggaggaacctatgccgcctcctaggattccaatctcg
gccacccttaacaacttatccagtgtcaaacaagccagtccatcaccgaatatgaagcaa
ggccctagcggttatctcgatacaaggagacgtaagagttcgggcggcagtctgaatggg
ctcattacacatgacaagaccaagagcgattcttggactgcgaaaaagcccgtccctgac
ccttcgacaatgcctgttggccgaaacacctctgttatgcaaaagattctccgccccagg
aattcctccggcctggcgaaaggccccgactcgtattctgctgatcttgataaggacgac
caagcagccgaagaggaaatggccaagctgggttctcgacgcaaggaaacagatgttgct
gccaggacattggacgccctcaaaaagcgggcgacaccaaaggaacgagtcggtgctcat
gaagccatccgtattgccatgctcaacatttatgagcgaggtgagattgtggattacacc
gacgttttcttctgcggaacacagaatgcacacaaagtggttggtgatcttcaatctgat
gcgcccaactttggctacgacgatgagcgtggagattataccattgtccccggagatcac
cttgcataccgatatgaaatcattgatgttctcggaaaaggtagttttggacaagtcgtc
cgctgcattgatcacaagacgggtggactagtggccatcaagatcattagaaacaagaag
agatttcaccaacaagctcttgttgaggtcaacatcttgcagaagcttcgcgaatgggac
ccaaagaacaaacacagcatggtcaacttcacacaaagcttctatttccgcggccatctc
tgtatctccacggagctgttggacatgaacctttacgaactaatcaaggcacacgcgttc
agaggtttctccatcaggatcattcggcggtttaccaagcagatcctcagctcactcaat
cttctcaaacaacataaagtcatccattgtgatctaaagcccgaaaacattctcctcaga
catcctcttcacgcagagatcaaggtcattgactttggctccagctgttttgaaaatgag
aaggtctatacatacattcagtcccggttctatcgatcccccgaggtcattcttggcatg
acttatggcatgcccattgatatgtggagtgttggctgcattttggcagagctatacact
ggagttcctatcttcccgggagaaaatgaacaagaacaacttgcatgtatcatggaggta
tttggacctcctgaaaagcacctgatcgagaagagcacccgaaagaagctcttcttcgac
tctatgggcaagcctcgcctcacggtatcttccaagggtcgcagacgccgtccttcctcc
aagactttgtcgcaagtactcaaatgcgacgatgaggtattcttggactttttgcaacgt
tgtttacgttgggatccagaaagacgactcaaacctgaggacgcgattcggcacgagttt
attactgggcgtaaaatgcctcttcctcgtatgccaccaacccgcgaatcgtcacctatg
aagcgacacaacactatctctactccacgacctctccccgaccccccaggcagtgccgtc
aagcctctaggatccttgcgatctggagctagcccccacaaacctgtttctggccctgtt
cgcaaagcctcaggacagatgggacccgtcagctccatgccaactaaacgaaccagcgcc
ggtacgactgggctcgcgcaaggggcgagcggtttgcctcgagctgctggcaggaccgtg
agcggaaagcaagatctggccgctgctggtgcaacggctgctatgagtcgacgatcatag

DBGET integrated database retrieval system