KEGG   Fusarium graminearum: FG10188.1Help
Entry
FG10188.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01254  
leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
fgr  Fusarium graminearum
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fgr00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 639 aa AA seqDB search
MSWFSSLKKPSILRTCQVTITHNLRRTFATVNPNMTANRDPSTLSNYSAWRTRHTTANFK
IDFDQKALKGSVVLQLESQTDKESKEIILDTRYVDISSISIDSKESKWELKSFNAPLGAP
LHIAVPDGVAKGELIDLAIDLQTTSKCTALQWLTPAQTSNKKHPYMFSQCQAINARSIFP
CQDTPDVKSTFSFKLTSSLPVVASGVPVGDHEATPGKEKLYEFEQKVPIPSYLFAVASGD
IATAPIGPRSIVATGPNELEGCKWELERDMEKFMEVAEKLVFPYKWGAYNVLVLPPSFPY
GGMENPIYTFATPTIISGDRQNVDVIAHELSHSWSGNLVSNASWEHFWLNEGWTMYLERR
IQAAIHGDAEFDFSAIIGWKDLENAVELFGKDHEYTKLIIKHEGVDPEDVYSTVAYEKGF
HFLYYLEGVVGRENFDKFIPFYFTKWSEKSLDSFEFKQTFLDFFNNLGNKEVAKKITEIN
WEEKFYTPGLPPKPEFDTTLANQCYDLANKWKDAKFEPNANDLEEFTANQKLVFLGEVQQ
SGDLTADRVQLMGKTYDFMSSKNVEILSAYYQIALQAKDSAIYQAAADLLGTVGRMKYVR
PLFRALNKVDRQLALDTFEKNKDFYHPICKGMVEKDLGL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggttttcgtcactcaagaaaccctccattttgcgaacctgtcaagtcacaatc
actcacaaccttagacgcacatttgctactgtcaacccaaacatgacggccaatcgggat
cccagtactctctcaaactatagcgcttggcgcacccgccataccaccgccaacttcaag
atcgactttgaccagaaggcgctcaagggctctgttgttctgcaactcgagtcacagact
gacaaagagagcaaggagattattctcgatactcgttatgtcgacatttccagtatcagt
atcgactccaaggagtccaagtgggagctgaagagcttcaatgcccctctcggtgcccct
cttcacattgctgtaccggatggtgttgccaaaggcgagctaattgaccttgcaattgac
ctccagacaaccagtaaatgtactgctctgcagtggctcactcctgctcagacatccaac
aagaagcacccgtacatgttttctcaatgccaggccattaacgctcgttccatttttcct
tgccaggacactcctgacgtcaagtctactttcagtttcaagctgacttcgtctctcccc
gttgttgccagtggtgttcctgtaggagaccacgaggcaactcctggtaaggagaagctt
tacgagtttgagcaaaaggtccctatcccctcttacctctttgctgtggcctctggtgat
attgcaactgctcctatcggtcctcgaagcattgtcgccacgggccctaacgagctggaa
ggatgtaagtgggaacttgagcgtgatatggagaagtttatggaggtggcagagaagctt
gtctttccctacaaatggggagcttacaacgttcttgtcttgcccccaagcttcccgtac
ggaggtatggagaaccccatctacaccttcgctacacccacaatcatcagtggtgaccgc
caaaatgtggacgttattgcccacgaactgagccacagctggagtggtaacttggtttcc
aacgctagctgggagcacttctggttgaacgaaggttggacaatgtaccttgaacgccgt
attcaagccgctatccacggtgatgccgagtttgacttttctgccatcatcggatggaag
gaccttgagaatgccgtagagctctttggcaaggaccacgaatacaccaagctcatcatc
aagcatgagggtgttgatcctgaggacgtctacagcaccgttgcttacgagaagggcttc
cacttcctctactacttggagggcgttgttggccgggagaactttgacaagttcattccc
ttttacttcaccaagtggtccgaaaagtcccttgattcattcgaattcaagcaaaccttc
ctcgactttttcaacaaccttggaaacaaggaagttgccaagaagatcaccgagatcaat
tgggaggagaagttctacacacccggtcttcctcccaagcctgagtttgacactacattg
gcaaaccagtgctatgatcttgcaaacaaatggaaggatgctaaattcgagcctaatgcc
aatgaccttgaggagttcactgcgaaccagaagcttgtcttcctgggtgaagtacagcag
tccggtgatctgactgcagaccgagtccagctcatgggcaagacgtacgattttatgtcg
tcaaagaacgtggagatcctttcagcatactaccagattgctctccaggccaaggattct
gctatttaccaggccgctgccgatctgctcggcacggttggtcgtatgaagtatgtgcga
cctctgttccgcgccctcaacaaggtggaccgacagctggcgctggacacctttgagaag
aacaaggacttctatcatcctatctgcaagggtatggtggagaaggatctaggtctttaa

DBGET integrated database retrieval system