KEGG   Fusarium graminearum: FG10280.1Help
Entry
FG10280.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
fgr  Fusarium graminearum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    FG10280.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 356 aa AA seqDB search
MSTLFGSASSAAATSIGDLKQDVALSDPPTDTISGLSFSPAPNGPDFLAISSWDNKVRIY
EIATNGQSQGRHAYEHSQPVLSCDFSKDGTKIVSAGADKNIKVCDLASQQDIVVGTHDQP
VRTARFFDSGNGPMVVSGSWDKTVKYWDLRQQGPAATVACQERVYTMDVRDNLCVVGTAD
RYINVIDLKNPTKFYKTLQSPLKWQTRVVSCFTDSAGFAIGSIEGRCAIQYVEAKDSSAN
FSFKCHRDPPANGVTNVHAVNDISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPNVGG
SITSTTFNKNGSIFAYAVGYDWAKGYQHNTQSYPIKVMLHPVTNDECKPRPSAKKR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactctctttggcagcgcctcgagcgcggcggcgacaagcatcggcgacctcaag
caagatgttgcgctttccgaccctcccaccgacaccatctccggcctctctttctctcct
gcgccaaacggtcccgactttttggccatctcgagttgggacaataaagtccgtatttac
gaaattgccaccaacggtcaaagccaaggccgacacgcatatgagcacagtcaacccgtg
ttgagctgcgacttctccaaggatggaacaaagatcgtctctgcaggcgccgacaagaac
atcaaggtctgcgatctcgcctcccagcaggacattgttgtgggcacacacgaccagcct
gtgcgaacagcccgattcttcgacagcggcaacggccccatggtcgtctcaggatcatgg
gacaagacggtgaaatactgggatctccgacagcaagggcccgccgccacagtagcttgt
caagaacgagtctatactatggacgttcgcgacaatctgtgtgtagtcggtacagccgat
cgctacatcaacgtcatcgacctcaagaaccctaccaaattctacaagactctgcagagc
cctctgaagtggcagactcgggttgtcagctgctttaccgactctgctggattcgccatc
ggcagtatcgagggacgttgcgctatccaatacgtcgaggccaaggactcaagcgccaac
ttctctttcaagtgccaccgtgaccctccagccaacggtgtcaccaatgtccacgccgtc
aacgacatttcattccaccccgtccacggcacattcagcactgccggctccgatggaaca
ttccacttctgggacaaggatgccaagcatcgtctcaagggttaccccaacgtcggaggc
agcatcacctctactacctttaacaagaacggttccatctttgcctatgctgttggctac
gactgggccaagggttaccagcacaacactcaaagctatcccatcaaggtcatgctgcat
cccgttaccaacgatgagtgcaagcccaggccatctgcgaagaagcgataa

DBGET integrated database retrieval system