KEGG   Fusarium graminearum: FG10292.1Help
Entry
FG10292.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     FG10292.1
Peptidases [BR:fgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   FG10292.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 927 aa AA seqDB search
MSNRHLPAGQNIQGGSGVLGADMVGPGGPRRRQPPPFVPQSQYQQQHHHHQAVNHMYNNN
YMNYGQQQYYGYPPQYQTGHYQNAQYHNAQYQGGQYQAAQFQNGQYQNAQYHNAGMPSPG
AYMGYQQHYGRSPPVHQFVPMSGVSVPPSFPTRPAQQQSPALPTQPPAPASLPPQTPTST
HSSQIIPTSTPPVTQETEPAPPAPPVAPAEPPRQPSPVPVPAAAAVPAPVHVHVHIPVPQ
EPFRAPLPWYSHPDEKFPVRTKRPGRWRKRLNADSANVSLPAIDQHNAAAEQASVPEASS
TEPSVSALTPATSTAPSEAAATPRQSSETPASVQQRSRANTATSATSTSTNRPATRSSAT
PAPALPSLPKANTKDAKPARAEKPVNGDAATESAPEQEVTAEDSEKPAESESTAAGPAPA
VKAPPSSWAKLFSKPASAAAGKTEESNGAAPVDTVANGRATESPAGTPNGAAPSFSKVNA
NSVAEAIHTFHVGLADQVSFLEPRGLINTGNMCYMNSISKRAVHSFKSDTPLIDAMIMFM
HEFKTIKSAAGVEPLRLALKNEELERYGEPFTPEFVYEAIRQLPRFASMRRGHQQDAEEF
LGFLLQSLDDECTTVLKNFTPDEAEHQLSAGSDAGGADDWLEVGRKQKSAVSRSSGSNSS
SPISRIFGGLLRSEFRVPGLKDSITTEPYQPLQLDIGSSDVRNVVDALRGLTRPERLQGD
FNSPRGKEVTATKQVFIESLPPVLILHLKRFQFDAEGNGTVKIWKKIGYPLELEIPREAL
SRQKRQTLGEEGMPKYKLISVVYHHGKNASGGHYTVDVRRQEGREWIRIDDTSIRRVRSE
DVAEGGEEEEVKNTRKDGSSLGNRFGAVLDEDAGDDDGWSKVTSPAGGAKKWSSVANGTN
GTPKAAKPIKDNIKDNKVAYLLFYQRV
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgccatctgccggctgggcagaatatacagggaggatctggcgtcctaggt
gccgacatggtcggtcctggagggcctcgtcggaggcagcctcctccctttgttccccag
tcccagtaccagcagcaacatcatcaccatcaagccgtaaatcacatgtataacaacaac
tacatgaactatggacagcagcagtattatggatacccgccgcagtatcagacaggtcac
taccagaacgctcagtaccacaacgcgcagtatcaaggtggacaataccaagctgcacag
ttccagaatggccagtaccaaaacgcacagtaccacaacgccggaatgccttcacccggt
gcttatatgggctaccagcagcactacggacgatcgccgcccgttcaccagtttgtcccc
atgtctggtgtgagcgtacccccgagcttcccaacccgcccagctcagcaacaatctcct
gctctgccgactcagcctcctgctccagcctcacttccaccccagactcctacttcaacc
cactcgtcgcagataattcctacttcaacccccccggtcacgcaggagactgagccagca
ccccccgctcctcctgttgcccccgctgagcccccacgacaaccttcacccgttcctgtc
cctgctgctgctgctgttcctgcccctgttcatgttcatgttcatattcctgttccacag
gaaccattccgtgcacctctgccatggtactctcacccggatgaaaagttccctgttcga
actaaaaggccggggcgatggaggaagcgtctcaatgcggacagtgcaaatgtttccctg
ccggctattgaccaacataacgctgctgcagagcaggccagcgttcccgaagccagctct
accgaaccttctgtctcggcccttacacccgcgacatcaacggctccatcggaggctgcg
gcaactcctcgccagtcttccgagactcctgcttctgttcagcaacgatcacgcgccaac
accgccaccagcgctacctcaacttcgacgaaccgtcctgccacacgctcctccgctact
cccgcccctgctcttccatcgcttcctaaggcaaacactaaggatgctaagcctgcacgt
gctgaaaagccggtaaacggcgacgcagctaccgaaagtgcccctgagcaggaggtcacc
gctgaagattccgagaagcccgcggagtctgaatcaaccgctgctgggccagctcctgct
gtcaaagctccaccttctagttgggcgaagcttttctcgaagcccgcttctgcagctgct
ggaaagactgaggagtctaatggcgccgctcccgttgacactgttgctaatggccgtgcc
accgaaagccctgctggaacccctaatggagctgctcccagcttctcgaaagttaacgcc
aactccgttgcggaggctattcacacgttccatgttggtctcgcggatcaagtttcattc
ctcgagccccgcggtctgatcaacaccgggaacatgtgttacatgaactctatcagcaag
cgtgctgttcacagcttcaagagcgatactcctcttattgatgcaatgatcatgtttatg
catgagttcaagaccatcaagtctgctgctggtgttgaacctctacgcttggcgctgaag
aacgaggagcttgagcgttacggagagcctttcactcccgaattcgtctacgaagccata
aggcagcttccacgattcgctagcatgaggcggggccaccagcaagatgccgaggaattc
cttggcttcctactgcagtctcttgatgacgagtgcactacagtcctcaagaactttact
cccgacgaagcggagcaccaactcagtgctggttctgatgctggcggtgctgacgactgg
ctggaagtcggcagaaagcaaaagtctgctgtttctcggtcctccggatctaactcatcc
agccctatttccagaatttttggtggtttgttgcgatctgagttccgtgtccctggtttg
aaggactccatcactactgagccttatcagccccttcagctagacatcggatcctctgat
gtgcgcaatgttgttgatgcgctccgaggtcttactcgacctgagcgtcttcagggagat
ttcaactctcctcgtggcaaggaggtcacggctaccaagcaggttttcattgagtcgctt
cctcccgtcctcatcctacacctcaagcgcttccagttcgacgcagagggtaacggaact
gtcaagatttggaagaagatcggttatccgttggagcttgagattccccgcgaagccttg
tctcggcagaaacgccagactttaggtgaagagggaatgcccaagtacaagttgattagc
gtggtgtaccatcatggtaagaacgctagtggtggacattacactgtcgatgtgcgacga
caggaagggcgcgagtggattcgtattgatgatacttccatccgccgagttcgaagtgaa
gatgtcgctgagggcggcgaagaggaggaagtaaagaatactcgtaaggatggctcttca
ttgggcaaccggttcggtgctgttctggacgaagacgctggagatgatgacggatggagc
aaggtcactagccctgctggaggagcaaagaaatggagcagcgttgccaacggtaccaac
ggcactcccaaggccgccaagccgatcaaggataacatcaaggacaacaaggttgcctac
ctgctcttctaccaacgagtataa

DBGET integrated database retrieval system