KEGG   Fusarium graminearum: FG10313.1Help
Entry
FG10313.1         CDS       T01038                                 

Definition
similar to AF492766_1 MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
fgr  Fusarium graminearum
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    FG10313.1
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     FG10313.1
Protein kinases [BR:fgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   FG10313.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 416 aa AA seqDB search
MGDLQGRKVFKVFNQDFVVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPDALDLLDKMLAFDPS
SRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVVEDVGQMRGMILDEVQRFRQNVRT
VPGQSGGGLQGQGVPVPLPQGNGQWTAEDPRPQEYAGHGNTGLEQDLQGGLDASRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacctacaaggacggaaggtcttcaaggtctttaaccaggactttgttgttgat
gagcgctacactgtcaccaaggagctcggccagggagcttacggtatcgtctgtgccgcc
gtcaacaaccaaaccaacgagggcgtagccatcaagaaggtcaccaatgtttttagcaag
aagattctggccaagcgcgccctgcgcgagatcaagctgctccagcacttccgcggccac
cgcaacatcacatgtttgtacgacatggacattcctcgacccgataacttcaacgagacc
tacttgtacgaggagctgatggagtgtgatttggctgccatcatccgatctggccagcct
cttaccgacgcccacttccaatcctttatctaccagatcctttgcggtctcaagtacatc
cactccgcaaacgttctgcaccgagatctcaagcccggtaacctgcttgtcaacgccgac
tgcgagctcaagatttgcgatttcggtcttgcccgaggtttctcagtcgaccccgaagag
aatgctggatacatgaccgagtacgtcgctactcgatggtaccgtgcacctgagattatg
ttgagcttccagagctacaccaaagctattgatgtttggtctgttggttgtattctggct
gagcttttgggcggacgacctttcttcaagggccgtgactacgtcgaccagctgaaccag
attcttcacattctcggaacccccaacgaggagaccctctcccgtatcggctcaccccgt
gcccaggaatacgtccgcaacctacctttcatgcccaagaagcctttccccagcctgttc
ccccaggccaaccccgacgctctcgaccttctcgacaagatgctcgccttcgacccttcg
tcccgtatcagtgtagagcaggctctcgagcacccttacctgcaaatttggcatgacgcc
tcggacgagcccgactgccccaccacattcaacttcgactttgaggttgttgaggacgtt
ggtcagatgcgtggtatgattttggatgaggttcaacgattccgacagaatgtccgtacc
gtgcccggccaaagcggtggaggtcttcagggccagggtgtccccgttcctctgcctcag
ggtaatggtcaatggactgctgaggaccctcgacctcaggaatatgctggtcatggtaac
accggacttgagcaggatcttcagggaggcctggatgcttctcgaagataa

DBGET integrated database retrieval system