KEGG   Fusarium graminearum: FG10606.1Help
Entry
FG10606.1         CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K00435  
peroxiredoxin [EC:1.11.1.-]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     FG10606.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 331 aa AA seqDB search
MGIVDQPQSKGQESTPGDFAAVQKSIIDLLNQPDYDDGSAGPVLVRLAWHSSGTYDKVTD
TGGSNGAGMRYEAEGGDPANAGLQNARVFLEPVKRLHPWITYSDLWTLAGVTAIHAMGGP
EIDWLPGRTDFVDDSKLPPRGRLPDAAQGAEHIRHIFYRMGFNDREIVALSGAHNLGRCH
TANSGFEGKWVNNPTRFSNQYFRLLLSETWTEKTIPESGLLQFSSVDQDTEEELMMLPTD
IALTTDSEFSKYVQLYAKDKDVFFQDFKKAFAKLLELGIARNSEGKVINTDNQKGGYRSA
PKKSDSTPATSGQPGASKTGGCPVMHHKAKL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgtagatcaaccgcaatcaaaaggccaagagtcaaccccaggtgactttgct
gccgttcagaagtcaatcattgatcttctaaaccagcctgactacgatgatggaagtgcc
ggacccgttcttgtgcgtcttgcttggcactcatccggcacatacgacaaagtaacagac
acaggcggttccaacggcgctggcatgcgatacgaagctgaaggtggagatcctgccaat
gccggcctacagaatgctcgtgttttccttgagcctgtcaaacgtcttcacccgtggata
acatactctgacctctggacactcgctggcgtgacggcgatacacgccatgggtggacca
gaaattgactggctgccgggacgaaccgactttgtcgatgacagtaagcttccgcctcgt
ggtcgtctcccagacgcagcacaaggagcagagcatattcgtcatattttctatcgaatg
ggattcaacgatcgcgagatcgtagctcttagtggtgcacataatcttggtcgttgccat
actgcaaactctggctttgaaggcaaatgggtcaacaaccctacccggttctccaaccag
tactttcgtcttttgctatcggaaacctggactgaaaaaacaattcccgagtctggcctg
ctccagttctcctccgttgatcaagatacagaggaggagttgatgatgcttcccactgac
atagcactcacgacggactctgagttctccaagtacgtgcaattatatgcaaaggacaag
gatgtatttttccaagactttaagaaagcatttgcaaagttgctggaacttggaatagca
agaaactcggaaggcaaggttatcaatactgataatcagaagggaggttatagaagtgcg
ccaaagaagagtgattcgacacctgctacttcaggtcaaccaggagcatccaagactggt
ggatgtcccgtgatgcatcacaaagcaaaattataa

DBGET integrated database retrieval system