KEGG   Fusarium graminearum: FG10881.1Help
Entry
FG10881.1         CDS       T01038                                 

Definition
CYC_NEUCR Cytochrome c
Orthology
K08738  
cytochrome c
Organism
fgr  Fusarium graminearum
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    FG10881.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 109 aa AA seqDB search
MTQISSGDIKKGANLFKTRCAQCHTVEKDGGNKIGPALHGLWGRKTGSVEGYSYTDANKQ
KGIEWNDDTLFEYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDSTK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
ctgactcaaatttcctcaggcgatatcaagaagggtgccaaccttttcaagacccgatgt
gctcagtgccacaccgttgagaaggatggtggcaacaagatcggacctgctctgcacggt
ctctggggccgcaagaccggttccgtcgagggttactcttacaccgatgccaacaagcag
aagggtattgagtggaacgacgacactctcttcgagtacctcgagaaccccaagaagtac
atccccggtaccaagatggccttcggtggcctgaagaaggctaaggaccgcaacgacctc
attgcctacctcaaggactccaccaaataa

DBGET integrated database retrieval system