KEGG   Fusarium graminearum: FG10961.1Help
Entry
FG10961.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
fgr  Fusarium graminearum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    FG10961.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     FG10961.1
Peptidases [BR:fgr01002]
 Metallo Peptidases
  Family M67
   FG10961.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 482 aa AA seqDB search
MDSRIAMRPTRPQTVKELVAQAENFSFNMNIPFKHWMRAAETLYQEASFAVSDGDFGRAY
MMLYRHSLLILKYLPTHPQFKEPDNKKAYIVLSKRIQRVIQDLEQLKPEIENAVKEWERM
ALSPKAAIESPDPPSRYEQFAARDPTLSGNARILDASDHQDLAVDLAQRELTRRDTVRRT
TRHSGIADEDIMSRRRGGKWDQWDGVRIGDDEDLRRQMEATRHALDSAHERRNDDDFRPT
SHTYNYPSISRPRPVEYERSTTPTTPSIQPSRPPKEPVALPPKEPLHPSLSQPLPPSLPQ
KVPLSGYAPLIPSPSPQTAGDRPEVPRKEALSPTGDAGPPAIPQKERLTFKPGAYLENGD
PIRSLFLPKNLRQKFLDIAADNTRRGLEMCGMLCGTPINNALFVRCLLIPDQKCTSDTCE
TENEEVMFDYCMSEDLLLLGWIHTHPTQTCFMSSRDLHTHAGYQVMMPESVAIVCAPKFQ
PS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggactccagaatagcgatgcggccaactcggccccaaaccgtcaaggagcttgttgct
caggccgagaatttcagcttcaatatgaacatcccgttcaagcactggatgcgtgcagca
gaaacgttgtaccaagaggcttcttttgcggtttcagacggcgacttcggacgagcttac
atgatgctgtatcgacactccctcctcatcctcaaatatcttccaacgcacccgcagttc
aaggaacccgataacaagaaagcctacatagtgctatcgaaacgcattcagcgcgtgatc
caagatctggaacagctcaaacccgaaatcgagaatgctgtcaaagagtgggagcgaatg
gcgctttcgccaaaggcggctatcgaatcaccagaccctccgtcacgatacgaacaattc
gcagctcgcgatccaacattgtccggcaatgctaggattctagatgcttccgaccatcag
gacctggcagttgatctcgcacaaagggaattgacacggagagacaccgtgagaaggacg
acgagacattctgggattgccgacgaagacattatgtcgagaagaagagggggtaaatgg
gatcaatgggatggtgtgcgaatcggagacgatgaggatctacggcggcagatggaggca
actaggcatgccctcgactcggcgcacgagagacgcaacgacgacgatttccgacccacg
tcgcatacttacaactacccatctatctccagacctcgaccggtcgagtacgagagaagc
acaacaccgacaactccatcaatacagccgagtcgaccgcctaaggaacctgtcgctctg
cctcccaaagaacccttgcatccgtctctatcacagccgctgcccccaagccttccacaa
aaggtgcccctatcaggatacgcacctcttataccatctccatcacctcaaactgctggt
gatcggcctgaggttcctcgcaaagaggcgctcagcccaactggagacgctggcccacca
gcaattccccagaaagaacgtctcacatttaagccaggcgcataccttgagaacggcgat
ccaattcgatctctcttcctaccgaaaaacctccgacagaaattcctcgacatcgctgct
gataacacgcgtcgtggacttgagatgtgtggcatgctgtgcggaacgcctatcaacaat
gcgctgtttgttaggtgtctcttgatacccgatcagaagtgcacgtcggatacgtgtgag
acagaaaatgaagaggtcatgttcgactactgcatgagtgaggatttgcttcttttggga
tggattcatacgcatccgacacagacatgtttcatgagttcacgagatcttcatactcat
gctggataccaggttatgatgcctgagagcgtggctatcgtgtgcgcgccaaagttccag
ccttcgtaa

DBGET integrated database retrieval system