KEGG   Fusarium graminearum: FG10967.1Help
Entry
FG10967.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fgr  Fusarium graminearum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FG10967.1
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FG10967.1
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     FG10967.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 325 aa AA seqDB search
MNTGLVNSRFLSKPDEVGVVAVGFSGGQPKAGVDIGPAALIQSGLLTEIRDELGYKLFGD
ETVQQFEDLIPESDPDFRGMKKPRHASAVTRKIASHTYEHSREGRMTLTLGGDHSIAIGT
IAGTAKATRERLNREIAVIWVDAHADINTPESSDSGNIHGMPVAFLTGLAKEEKEECFGW
LEDDMRLNVKKLVYIGLRSVDIGEKKILREHGIKAFSMHDVDRHGIGRVVEMALAHIGND
TPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDFICESVHETGNLVAIDLVEVNPHLAD
TKQAEQNTIHAGCSLVRCALGETLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacactggtcttgtcaacagccgcttcctctccaagcctgatgaggtcggcgtcgtt
gctgtcggtttctcaggcggtcagcccaaagctggtgtcgacatcggccccgctgctctc
atccagtccggtcttctcactgagatccgtgatgagctcggttacaagctcttcggtgac
gagaccgtccagcagtttgaggatctgatccctgagtcagaccctgacttccgcggtatg
aagaagccccgccatgcatctgcggtgactcgcaagatcgcttcgcacacctatgagcac
tcccgcgagggacgcatgactcttacccttggcggcgatcacagcatcgccattggtact
attgccggaactgccaaggctacccgggagcgtctgaaccgcgagatcgctgttatctgg
gttgatgcgcacgccgacatcaacactcctgagagcagtgacagtggtaacattcatggc
atgcctgttgctttcttgaccggtctggccaaggaggagaaggaggagtgctttggctgg
ctcgaggatgatatgcgcctgaacgttaagaagctggtgtacatcggtcttcgatccgtt
gacattggcgagaagaagatcctccgtgagcacggcatcaaggctttcagcatgcacgat
gttgaccgtcacggtattggccgcgtcgtcgagatggcccttgctcacatcggtaacgac
actcccatccacctgtcctttgatgtcgatgccctcgaccccatgtgggctcccagcacc
ggcacacccgtccgcggcggtctcactctccgtgaaggcgactttatctgtgagagcgta
cacgagacgggcaacctcgttgccattgacctggtcgaggtgaaccctcacttggctgat
accaagcaagctgagcaaaacacaatccacgctggatgctcactggtgcgatgcgcgctg
ggtgagacccttctataa

DBGET integrated database retrieval system