KEGG   Fusarium graminearum: FG10999.1Help
Entry
FG10999.1         CDS       T01038                                 

Definition
similar to endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fgr  Fusarium graminearum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 231 aa AA seqDB search
MVSFKSLLVAVSALTGALARPFDFLDERDDGNATSVLEARQVTGNSEGYHNGYFYSWWSD
GGGYAQYRMGEGSHYQVDWRNTGNFVGGKGWNPGTGRTINYGGSFNPQGNGYLCVYGWTR
GPLVEYYVIESYGSYNPGSQAQHRGTVYTDGDTYDLYMSTRYQQPSIDGVQTFNQYWSIR
RNKRTSGSVNMQNHFNAWRSAGMNLGNHYYQILATEGYQSSGSSSIYVQTS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtctcgttcaaatcccttctcgtcgccgtctcggcactcactggggcacttgctcgt
ccctttgacttcctcgatgagcgtgacgatggcaacgccacctcggtcctcgaggctcgc
caagtcactggcaacagtgaaggttaccacaacggttacttctactcttggtggtctgat
ggtggtggttatgctcagtaccgtatgggtgagggcagccactaccaggttgattggcgc
aacactggtaactttgtcggtggaaagggatggaaccctggtactggccgaaccatcaac
tacggaggttccttcaaccctcagggtaacggatacctttgcgtttacggatggacccgc
ggtcccctcgtcgagtactacgtcatcgagagttacggttcttacaaccccggcagccag
gctcagcaccgaggtaccgtctacaccgacggtgacacctacgatctctatatgtccacc
cgttaccaacagccttcgatcgacggtgttcagaccttcaaccagtactggtccatccgc
cgcaacaagcgtaccagcggctccgtcaacatgcagaaccacttcaatgcttggagatct
gctggcatgaacctcggaaaccactactaccagattctggccactgagggttaccagagc
agtggctcatcttctatctatgtccagactagttaa

DBGET integrated database retrieval system