KEGG   Fusarium graminearum: FG11304.1Help
Entry
FG11304.1         CDS       T01038                                 

Gene name
XylD
Definition
endoxylanase D
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     FG11304.1 (XylD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 381 aa AA seqDB search
MHFLGLVVAFAPAALAQSAIWGQCGGTGWSGSTTCQSGLKCEKINDFYYQCIPGSDNGGG
TTPDPGTPSPGNGNADATGLDAKIRAKGKIYFGTEIDHYHLSNNPLINIVKKDFGQVTNE
NSMKWDAIEPSRGQFTFSNADKVVDFAQANGKKIRGHTLLWYSQLPQWVKNIRDRATMTS
VIENHVKTVVTRYKGKILHWDVVNEIFAEDGNMRNSEFYQVLGEDFVGIAFRAARAADPA
AKLYINDYNLDIANYAKVTRGMVDHVNKWVSQGIPIDGIGSQAHLAKPGGWNPASGFPAA
LKVLAGANVKEVAITELDIDGAAANDYVTVVNSCLTTPKCVGITVWGVSDKDSWRSESNP
LLFDRNYQPKAAYTAVSNALN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcctaggactcgtcgttgctttcgcccctgcggctcttgcccagtctgctatc
tggggacagtgtggtggtaccggctggtctggctccacgacttgccagtctggcttgaag
tgtgagaagatcaacgacttctactaccagtgtattcctggaagtgacaacggcggcggt
actacccccgaccccggcacgccttctcctggtaatggcaacgctgatgccactggtctt
gacgctaagatcagggccaagggcaagatctacttcggtactgagatcgaccactaccat
ctcagcaacaaccctctcatcaacatcgtcaagaaggactttggtcaggtcaccaacgag
aacagtatgaagtgggatgccattgagccttctcgtggccagttcaccttcagcaacgct
gacaaggtcgtcgactttgcccaggccaatggcaagaagatccgtggccacactctcctg
tggtactctcagcttccccagtgggtcaagaacatccgtgaccgcgccaccatgacctct
gtcatcgagaaccacgtcaagaccgtggtcacccgctacaagggcaagatcctccactgg
gacgttgtcaacgagatcttcgctgaggacggaaacatgcgaaacagtgagttctaccag
gttctcggcgaggactttgtcggtattgctttccgcgctgcccgcgccgccgacccagct
gccaagctctatatcaacgactacaacctcgatatcgccaactacgccaaggttacccgc
ggaatggttgatcacgtcaacaagtgggtttctcagggtattcccatcgacggtatcggt
tcccaggctcatcttgccaagcccggtggctggaaccctgcctctggtttccctgccgct
ctcaaggtcctcgctggtgccaacgtcaaggaggttgccattaccgagcttgacattgat
ggagctgctgccaacgactacgtcaccgttgtcaactcttgtctcacaacccccaagtgt
gttggcatcaccgtctggggtgtttctgacaaggactcgtggcgatcagagtctaaccct
ctcctcttcgaccgcaactaccagcccaaggctgcttacaccgctgtgagcaacgccctc
aactaa

DBGET integrated database retrieval system