KEGG   Fusarium graminearum: FG11345.1Help
Entry
FG11345.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fgr  Fusarium graminearum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FG11345.1
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FG11345.1
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FG11345.1
Enzymes [BR:fgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FG11345.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 412 aa AA seqDB search
MAKSCSSMAISEQSHSSVWPDSNGYFGQFGGNYYPSEAHQALKELAEKYEELRHQSDFLR
QLEKVRTGLQGRPTPIHYLENISQQVGGAQIYVKREDLNHTGAHKINHCVGFALLAKAMG
KTKLIAETGAGQHGVALATAAAYFGLECEIHMGAVDMEKQKSNVGRMQILGARVVSATAG
QSALKDASDSAFNAYIEQREHALYAIGSAIGPHPFPLIVRDFQSVIGQEAREQFLAMTDG
KLPEHVVACVAGGSNAMGMYSAFIEDKDVKLHAAEPLGRSSQLGEHAATLSYGKPGTLHG
AKTLVIQKEEGLPASVSSVASGLVYPGIGPEMAMLHEAGRISVGAIRDEEVISTFFQMAK
TEGIIIALESAHAVAYAIRLAGERPKSERIIVNLSGRGDKDVDYVLQNYGTG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtcttgctcttccatggccatctctgaacagtctcattctagtgtttggcct
gattctaacggctactttggccaatttggaggcaactattatccatctgaagctcatcaa
gccctcaaagaactagcggagaaatacgaagaacttcgacatcagtcagactttctccga
cagctcgaaaaagtccgcaccggtcttcaaggtcgtccaacacctatacactacttggaa
aacatttctcaacaagtcgggggtgctcagatttacgtcaagcgagaagatctcaaccat
accggcgcccacaagatcaaccactgcgtcggtttcgcactccttgccaaggctatgggc
aagaccaagttgattgctgagactggagcgggacaacatggcgtcgctcttgccactgcc
gctgcctactttggccttgaatgcgagatccacatgggtgctgttgatatggagaaacag
aaatccaacgttggtcgcatgcaaatactcggtgccagggttgtgtctgcaacggcaggg
cagtctgctcttaaagacgctagcgactcagccttcaacgcgtatatagagcagagggag
catgctttgtatgccattggatcagctatcggtcctcatccgtttccattgattgtgcga
gactttcaatctgttatcggccaagaagcgagggaacagttccttgccatgaccgacggg
aaactacccgaacatgttgttgcttgcgtcgcgggtgggtccaatgcaatgggcatgtac
tcggctttcatcgaagacaaggacgtcaagttacacgccgccgaaccacttggtagatct
agtcagcttggcgagcatgcagccacgttatcctatggcaaaccaggaactttgcatggc
gcaaaaactcttgtcatacaaaaggaagagggtcttcctgcttcggtctcatctgtggct
tctgggctggtttatcctggaattggaccagagatggcaatgctacatgaagctggacga
atatccgttggggcaatacgtgatgaagaggtcattagtacctttttccaaatggccaag
accgagggaatcattattgctctcgagagtgcacatgctgtggcttatgctatacgttta
gcgggagaacgccccaagtctgaacgaatcattgttaatttgtctggtcgtggagataaa
gacgtcgattatgtacttcagaactacgggactgggtaa

DBGET integrated database retrieval system