KEGG   Fusarium graminearum: FG11450.1Help
Entry
FG11450.1         CDS       T01038                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fgr  Fusarium graminearum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    FG11450.1
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FG11450.1
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     FG11450.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 412 aa AA seqDB search
MDDVFRRYAICRDDSDLAATGSLPAMHIGFQTLAIALGASSLVAAAPAEASAVELMQNLN
RQAINALESTFAQSTERSTAKKCTLSNAAVRRDWRALSKKEKKAYIKAVLCLREKPSKAD
PAFAPGARTRYDDFVAVHINQTRSIHGTGNFLTWHRYFTWAYEKTLQDECGYKGTQPYWN
WFETRDFAVDPVFDGSDTSMGGDGEFFKHNGSSGGRGTILLPSGNGGGCIKSGPFAGAVA
NLGPPAPSMDGMEATTTPLEYNPRCLRRDLTRYAVDQWLTYPNLHNVTLGVASRNIDIMQ
TEFQGRFPDGFLGLHGAGHYTMGGDSSDLYSSPNDPNFFLHHSMVDRVYWIWQALHPKQA
NDIAGTITIGNMPPSRDALKSDPLNMGVNAREITIGDALNTLSGSPLCYIYL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgtatttcgacgctacgctatttgcagagatgactccgacttggcagcgaca
gggagtctcccagctatgcatatcggtttccagacactcgccatcgctcttggcgcctcg
tcgctggttgcggctgcacctgctgaggcatctgcagttgaactaatgcagaaccttaac
cgacaagcaataaatgcgcttgaaagtaccttcgctcaatccaccgaacgatccacagct
aaaaaatgcacactgtccaacgcagctgtgcgtcgcgactggagagccctatctaagaag
gagaagaaggcctacatcaaggctgtcctgtgtctacgcgagaaaccttccaaagctgat
ccagccttcgcacccggtgcccgcactagatatgacgactttgtagctgtccatatcaac
caaactaggagtatccacggaacaggtaacttcctcacctggcatcgatacttcacttgg
gcatacgagaagactcttcaagatgaatgcggctacaagggtactcaaccttattggaac
tggttcgagactcgggactttgctgttgacccggtatttgatggctcagacaccagcatg
ggcggcgacggagaattcttcaaacataacggatcatctggtggaagaggaaccattctt
ctacctagtggcaacgggggcggttgtatcaaatccggccccttcgctggtgcggttgcc
aatctcggcccccctgcccccagcatggacgggatggaagcaaccacgacacctctcgag
tacaacccccgttgtctccgtcgtgacctcacccgttacgctgtggatcagtggttgact
tacccaaacctgcacaacgttacactcggcgttgcttcacgtaacatcgatatcatgcag
accgaatttcaaggaaggtttccagatgggttcctaggcttacacggagctggccattac
acaatgggtggtgacagctctgatctgtactcctcaccaaatgaccccaactttttcctt
catcattctatggtggatcgagtttactggatttggcaagcgcttcaccccaagcaggcc
aacgatattgcaggaaccataactattggtaatatgcctcccagcagagacgctctcaag
tctgatcctttgaatatgggagtcaatgctcgagagattaccattggtgacgcactcaac
actctgagtggctcgccactctgctatatctatctctag

DBGET integrated database retrieval system