KEGG   Fusarium graminearum: FG11487.1Help
Entry
FG11487.1         CDS       T01038                                 

Gene name
XylC
Definition
endoxylanase C
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     FG11487.1 (XylC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 327 aa AA seqDB search
MKFSSLLFTASLVAAMPASIEPRQAQESINKLIKAKGKLYYGTITDPNLLQSQQNNAVIK
ADFGQVTPENSMKWDATEPQQGKFNFGGGDQVVNFAAQNGLKVRGHALVWHSQLPQWVHN
IKDKTQMKNAIENHIKNVAGHFKGKVYAWDVLNEIFDWDGSLRKDSPFTQVLGEEFVGIA
FRAARAADPNAKLYINDYSIDDPNAAKLKAGMVAHVKKWVSQGIPIDGIGSQTHLDPGAA
NGVQAALQQMASTGVKEVAITELDIRSAPAADYATVTKACLNVPKCVGITVWGVSDKDSW
RKEKDSLLFNAQYQAKPAYTAVVNALR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcttccctcctctttaccgcctcgctggtcgcggccatgcctgcctccatc
gagcctcgccaggcccaggagagcatcaacaagctgatcaaggctaagggcaagctctac
tatggcaccatcaccgaccccaaccttctccagagccagcagaacaacgccgtcatcaag
gccgacttcggtcaggtcacccccgagaactccatgaagtgggatgccaccgagcctcag
cagggcaagttcaactttggcggcggtgaccaggtcgtcaactttgccgcccagaacggc
ctcaaggtccgaggccacgctcttgtctggcactctcagcttcctcagtgggtccacaac
atcaaggacaagacccagatgaagaacgccatcgagaaccacatcaagaacgttgctggt
cacttcaagggcaaggtctacgcctgggatgtcctcaacgagatcttcgactgggatggt
tccctccgcaaggactctcccttcactcaggttctgggtgaggagttcgttggcattgcc
ttccgcgctgcccgcgctgctgaccccaacgccaagctgtacatcaacgattacagcatt
gacgaccccaacgccgccaagctcaaggctggtatggtcgctcacgtcaagaagtgggtc
tcccagggcatccccattgacggtatcggttctcagacccatctcgaccccggtgccgcc
aacggtgtccaggctgctctccagcagatggcttccactggtgtaaaggaggttgccatc
actgagctcgacatccgctctgcccctgctgccgactacgctaccgttaccaaggcttgc
cttaacgttcctaagtgtgtcggtattactgtctggggtgtctctgacaaggactcttgg
cgcaaggagaaggacagccttctcttcaacgctcagtaccaggctaagcccgcttacacc
gctgttgtcaacgctctccgttaa

DBGET integrated database retrieval system