KEGG   Fusarium graminearum: FGSG_02339Help
Entry
FGSG_02339        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
fgr  Fusarium graminearum
Pathway
fgr00052  Galactose metabolism
fgr00500  Starch and sucrose metabolism
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FGSG_02339
   00500 Starch and sucrose metabolism
    FGSG_02339
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     FGSG_02339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 23549721
NCBI-ProteinID: XP_011318248
UniProt: I1RF73
Position
1
AA seq 549 aa AA seqDB search
MRNNLLSTVVGLSQFYSVAIAQSSTTIAVPTGTPIAGNYNGTYRPQVHFSPPEHFMNDPN
GMFRDADGLWHLYYQYNPTAVVAGNQHWGHATSKDLYHWVNQPIALFPPEEDTYVFSGSV
VVDENNTSGFFPDQDNGVVAIYTLSSPEVQDQAIAYSRDGGYTFEPYKGNPVINSTSTQF
RDPKVIRYNDSWIMVVAYPQDFAIGIFESSDLKEWTATSNFSHHGLLGLQYECPNMISIP
YIDEDGKKQDDMWLMAISINPGAPLGGSITEYFPGHFNGTHFEAVDGAARIADFGKDNYA
GQWFYGLSEDENPVSIAWASNWQYTQIVPTGDEGWRSAMSLPRENYLTKAKRVGWKLVSK
PYDLEPVMGRELASNDSFGNSTITVDYSDVESNAIYWEVNVTGIPDFGISSTASMNFTFL
SPVSGESVKAGYYFGGDPVYFLDRGNTRGFDNVFFTDKTSLASLAASDGSWNTSGVIDRS
IFEGFLNGGVDSVTNTFFATEPLTLMIFSTSDLPEDVKVSISVYSLDSAWQKMEGKDGLV
HGNTTSKAD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaatctcttgtcgaccgttgttggtctttcccaattttattctgtggctatt
gcccagtcttccaccacaatcgctgttcccactggcacacccattgctggcaactacaat
ggcacctatcgtccccaagtccacttctcaccacctgaacatttcatgaatgatcccaat
ggcatgttccgtgatgctgatggcctgtggcatttgtactaccagtacaaccctacagct
gtcgtcgctggtaaccaacactggggccatgccacatcaaaggacttgtatcattgggtg
aaccaacccattgccttgttcccgccagaggaggatacatacgtcttctctggaagtgtt
gttgtcgacgagaacaacacttctggcttcttccctgaccaagacaacggagtcgttgca
atctatactttatcatcgccagaagttcaggatcaagctatcgcctactcccgagatgga
ggctacactttcgagccttacaagggaaacccagtcatcaacagcacgtctacacagttc
cgtgaccccaaggtcattcgttacaatgactcttggatcatggttgttgcatacccccaa
gactttgccatcggcatctttgagtcctctgatctgaaagagtggaccgccaccagcaac
ttttcccaccatggtctgctcggcctgcaatatgagtgccccaacatgatctctatcccg
tacatcgatgaagatggcaagaaacaagatgacatgtggctcatggcgatcagcatcaac
ccaggtgctcccttgggaggttctatcactgaatacttccccggtcacttcaatggtacc
cacttcgaggccgttgatggtgctgcgcgaattgcagatttcggaaaggacaactacgcc
ggacaatggttttatggcctttctgaggacgaaaaccctgtgtccatcgcttgggcttcc
aactggcagtacacacaaatcgttcccacaggagatgaaggctggcgaagcgccatgagt
cttccccgtgagaactacttgaccaaggcaaagcgtgtcggctggaagttggtatcaaag
ccctacgaccttgaaccagttatgggccgtgagctcgcttccaacgacagctttggcaac
tcaacaatcactgtggactattccgatgttgagtccaatgcgatctactgggaagtcaac
gtcactggcatcccagattttggcatctcttcaactgcatccatgaacttcacattcctg
tctcctgtctctggcgaaagtgtcaaggcaggatactacttcggtggcgacccagtgtac
ttcttggatcgtggcaacacccgcggcttcgacaacgttttcttcactgacaagacatct
cttgcaagcctagcagccagtgatggctcatggaacacgagcggcgtgattgatcgttcc
atctttgaaggtttcctcaacggaggtgtggatagcgtgacaaacacgttcttcgccaca
gagccattgaccctcatgattttcagcacatctgatctgccagaggatgtcaaggttagc
attagtgtttattctttggatagtgcatggcaaaagatggagggcaaagacgggcttgtg
catgggaacacaacttccaaggcagactag

DBGET integrated database retrieval system