KEGG   Filomicrobium sp. W: BN1229_v1_1534Help
Entry
BN1229_v1_1534    CDS       T03856                                 

Gene name
yqeF
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fil  Filomicrobium sp. W
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:fil00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN1229_v1_1534 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    BN1229_v1_1534 (yqeF)
   00640 Propanoate metabolism
    BN1229_v1_1534 (yqeF)
   00650 Butanoate metabolism
    BN1229_v1_1534 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    BN1229_v1_1534 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    BN1229_v1_1534 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN1229_v1_1534 (yqeF)
   00310 Lysine degradation
    BN1229_v1_1534 (yqeF)
   00380 Tryptophan metabolism
    BN1229_v1_1534 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN1229_v1_1534 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN1229_v1_1534 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN1229_v1_1534 (yqeF)
Enzymes [BR:fil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN1229_v1_1534 (yqeF)
Exosome [BR:fil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN1229_v1_1534 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1465412..1466602
Genome map
AA seq 396 aa AA seqDB search
MSQDNETIVIASAARTPVGSFNGSLAAVPAHELGKVAITAALERAGVQPNEVSEVILGQV
LTAGAGQNPARQASIAAGLPIETTAWGMNQVCGSGLRAVALGAQQIMTGSASIVVAGGQE
NMSMSPHCMHLRDGVKMGDAKMIDTMIRDGLWDAFNGYHMGTTAENVARQFQITREEQDA
FAAASQNKAEAARKAGKFKDEIAPVTVKTRKAEVVVDQDEYIKEGVTAESIAKLRPAFDP
KEGTVTAANASGINDGAAVALLMTAAEAKRRGLTPLARIVSWATAGVDPSVMGTGPIPAA
KKALEKAGWSADDLDLIEANEAFAAQACAVNKGLGWDLSKVNVNGGAIAIGHPIGASGCR
ILNTLLFEMRRRDARKGLATLCIGGGMGIALCVARD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagataatgagacgatcgtaattgctagcgcggcacgcacgcccgtcggttcg
ttcaatggctcgttagcggcggttccagcccacgaactcggaaaagtcgccattacggcg
gcgttggagcgggctggcgttcaacccaacgaggtctccgaggttattctcggtcaggtt
ttgacggccggtgccggtcaaaatccagcccgtcaggcgtccatcgcggcgggtctcccg
attgaaacaaccgcttggggtatgaaccaggtctgcggctccggtctgcgcgccgtggcg
ctcggcgctcagcagatcatgactgggtcggcttccattgttgtcgccggtggccaggaa
aacatgagcatgtcgccccactgcatgcatctgcgcgacggtgtgaagatgggcgacgcc
aagatgatcgacaccatgatccgcgatggcctgtgggacgcctttaacggctatcacatg
ggaacgaccgctgaaaacgttgcccgccagtttcagattactcgcgaagagcaagacgcc
ttcgcagctgcgtctcagaacaaggcggaagcagcccgcaaagccggtaagttcaaggat
gaaattgcaccggtgacggtcaagacgcgcaaggccgaggtggtcgtcgatcaggacgag
tacatcaaggaaggcgtcactgcggaatcgattgcgaagctgcgtccggcttttgatcct
aaggaaggcaccgtaacggccgctaacgcatccggcatcaacgacggtgcggcggttgca
ctgctgatgacggcggctgaagccaagcgtcgtggcttgaccccattggcgcgcatcgtg
tcatgggcaacggccggcgtcgatccgtccgtcatgggtaccggcccgatcccagcagcc
aagaaagcactcgaaaaggctggctggtcagcggatgacctcgatcttattgaggccaat
gaagccttcgcggcgcaggcttgcgcggtcaacaagggactcggctgggacctttccaag
gtcaacgtcaacggcggcgctattgctatcggccatcccatcggagcttcgggctgccgc
attctcaatacgctgctgttcgaaatgcgtcgtcgtgatgcgcgcaaaggcctggcaacc
ctgtgcatcggtggcggtatgggcatcgctctttgcgtcgcccgcgattga

DBGET integrated database retrieval system