KEGG   Flavobacterium indicum: KQS_01145Help
Entry
KQS_01145         CDS       T01781                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fin  Flavobacterium indicum
Pathway
fin00020  Citrate cycle (TCA cycle)
fin00310  Lysine degradation
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01130  Biosynthesis of antibiotics
fin01200  Carbon metabolism
Module
fin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KQS_01145 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KQS_01145 (sucB)
Enzymes [BR:fin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KQS_01145 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: CCG52224
UniProt: H8XNV7
Position
complement(257216..258433)
Genome map
AA seq 405 aa AA seqDB search
MILEMKVPSPGESIKEVEIATWLVKDGDYVEKDQAIAEVDSDKATLELPAEMSGIITLKA
EEGDTVAVGAVVCLIDTSASKPEGGANASTTEAPKAEEKKAEVPKAAPVQETTYATGSAS
PAAKKILAEKNIQPSDVVGTGKGGRITTEDAMNAKASMGTPTGGSRSSERSKLSMLRRKV
AERLVAAKNETAMLTTFNEVDMSAIYALRDQYKDEFKAKHGLGLGFMSFFTKAVTRALQL
YPDVNSMIDGQEKISYDFCDISVAVSGPKGLMVPVVRNAELLTFRGVEAEIKRLALRARD
GQITVDEMTGGTFTISNGGVFGSMLSTPIINPPQSGILGMHNVVERPIVKNGQIVIAPVM
YVALSYDHRIIDGRESVGFLVAVKEALENPIEILMENNPKKALEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcaccaggggaatcaatcaaagaagtagaaatcgct
acatggttagtgaaagatggagattatgtagaaaaagaccaagcgattgcagaggttgat
tcagataaagcaacactagaattacctgctgagatgagtggtataatcactttaaaagca
gaagaaggtgacacggtagcagtaggcgctgtagtttgtttaattgatacttcagcttca
aaacctgagggtggtgctaatgcttcaactactgaagctccaaaagcagaagagaaaaaa
gcagaagttccaaaagcagctccagttcaagaaacaacgtatgcaacaggatctgcatct
cctgcagctaagaaaattttagcagaaaaaaatatccaaccttctgatgttgttggtact
ggtaaaggtggaagaatcacaacagaagatgctatgaatgcaaaagcatcaatgggtaca
ccaactggaggttctcgttcttctgaaagatctaaattatcaatgttacgtagaaaagta
gctgaacgtttagttgctgctaaaaacgaaacagctatgttaactacttttaacgaagta
gacatgagtgctatttatgccctacgtgaccaatataaagatgaatttaaagcaaaacac
gggttaggtttaggtttcatgtctttcttcacaaaagcagtgactagagcattacaatta
tatccagatgtaaactctatgattgatggtcaagaaaagatttcatatgacttctgtgat
atttcggttgctgtatctggaccaaaaggtttgatggtaccagtagtaagaaatgcagaa
ttattaacgttccgcggagtagaagctgaaattaaacgtttggctttacgtgcacgcgat
ggtcaaattactgttgatgaaatgacaggtggaacatttactatttcaaatggtggtgta
tttggatccatgttatctactccaattattaatcctcctcaatcaggaattttaggtatg
cacaacgtagtagagcgaccaattgttaaaaacggacaaattgttattgcacctgttatg
tatgttgccttatcgtatgatcacagaatcatcgatggtcgtgagtcagttggattctta
gtagcagtaaaagaagcattagaaaatccaatcgaaatcttaatggaaaacaatcctaaa
aaggcattagaactttag

DBGET integrated database retrieval system