KEGG   Flavobacterium indicum: KQS_02260Help
Entry
KQS_02260         CDS       T01781                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fin  Flavobacterium indicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KQS_02260
Enzymes [BR:fin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KQS_02260
Peptidases [BR:fin01002]
 Cysteine Peptidases
  Family C44
   KQS_02260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535028..536893
Genome map
AA seq 621 aa AA seqDB search
MCGISGFNNNIVTHFNRNSLIKNFNELQIHRGPDYTGTWMNEDFTFFHHRLALIDGSSNA
NQPFFNENYVLCFNGEIYNFKKLKQVLSSVQFKSSSDTEVLFYYLVNFGIEKTLQDIQGM
FAFSFYDIAKKELFLARDRFGIKPLYFYKNGSQFAFASESRTLAKALNLKPDSYKTIMAM
NSTAEGSTTYSLFNHVENIQPGSFVKIDTQLNLSEHFYYRLANDVDVHLHNDLKKLSKKQ
IVDQFDNLMSKSVEEMLVSDFPMGAFVSGGIDSSIITALAKEKISDFSLFTADINGKHSE
YEDTKALANHLKLPLFKTDFKPEDFLSYWVQATEYNAAPKVYFTNGIPISRVASLARQHE
VKAVICGEGSDELFLGYSKLMAQRYKKALLFPHDLIKKLYKIYPALNNYLFPSNDSNLDA
FNIRFANGFKSEMLYEAGNEVYSFISNKERKYYVDSFEMAQKHLHALFHRNDRMGMISSI
EVRFPFLHEEVVKFAVNLPLEYKTRWTTKLHNKKHPFITDKWIVREISKKHLPKNLVSKK
KNGLPIEGLNGLKFDKSFFKNGYLAEIMHLNNAALEHIIKNENPYFIGKLASVEIFGLLY
DYQLSNEEIQSKINQFITLKK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttcggggtttaacaataatattgtaacccattttaaccgtaattcatta
attaaaaattttaatgaattacaaattcataggggtccagattataccggaacttggatg
aatgaagactttactttttttcatcatagattagcattaatcgatggttcttctaatgct
aatcaacctttttttaatgaaaattacgtgctttgctttaatggtgaaatttataatttt
aaaaagttaaagcaagtattatcttctgttcaatttaaatcgtcttcggataccgaagtg
ttgttttattatcttgtaaattttggaattgaaaaaacacttcaagatatacaaggaatg
tttgccttctccttttacgatattgcaaaaaaagaattgttcctagctcgggatcgcttt
ggtataaaacccttgtatttttataaaaacggaagtcaatttgcttttgcatcagaatcg
aggacattagcaaaggctttaaatttaaaacccgattcgtataaaacaatcatggcaatg
aatagtacggccgaaggaagtactacttattctttgtttaatcatgtagaaaatatacaa
ccaggatcgttcgtaaaaatagatactcaacttaatttgtcggaacatttttattaccga
ctggctaatgatgtggatgtacatttgcacaacgacttaaagaaactttctaaaaaacaa
attgttgatcaatttgataacttgatgtctaagtcggttgaagaaatgttagtcagtgat
tttcctatgggcgcttttgtgagtggtggaatcgactcgtcaatcattactgcgcttgca
aaagagaaaatttccgattttagtttgtttaccgctgatattaatggtaaacactcggaa
tatgaagacacaaaagccctagcgaatcatttaaaattacccttgtttaagaccgatttt
aaaccagaagattttcttagttattgggtacaagcaacagagtataatgccgctccaaag
gtttattttacaaacggaattcctatttctagagtggcaagtttggcaagacaacatgag
gtaaaagcggtaatttgcggtgaaggttctgatgaactttttttaggttattctaaatta
atggcgcaacgttataagaaagcgttactttttcctcatgatttaattaaaaagctatat
aaaatttatcccgcattaaataattatttatttccatcaaatgattcaaacttggatgct
tttaatattcgttttgctaacggatttaaaagtgaaatgttgtacgaagccgggaatgaa
gtttatagttttatatcgaataaagaaagaaaatattatgtagattcttttgaaatggct
caaaaacatttgcatgcgttgtttcaccgaaatgatcgaatgggaatgatttcttctatt
gaagtgcgttttccatttttacatgaagaggtagtgaaatttgcagtcaatttacctttg
gaatataaaaccagatggacaacaaaactgcataataaaaaacatccttttattacagat
aaatggatagttagagaaatttcgaaaaagcatttaccaaagaatttagtttctaaaaag
aaaaatggtttacctattgaaggtttaaacggacttaaatttgataaatcgttctttaaa
aatggttatttagcggaaattatgcatttaaataacgctgctttagaacatattattaaa
aatgaaaatccgtattttattgggaaattagcttctgttgagattttcggactcttgtat
gattaccaattatcaaacgaagaaattcaatctaaaatcaatcaatttattaccttaaaa
aaataa

DBGET integrated database retrieval system