KEGG   Flavobacterium indicum: KQS_02370Help
Entry
KQS_02370         CDS       T01781                                 

Gene name
dfrA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fin  Flavobacterium indicum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fin00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fin00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564597..565082
Genome map
AA seq 161 aa AA seqDB search
MLTIIAAAAENNALGKDNQLVWHLPDDFKRFKSLTSGHYIIMGRKTFESFPKPLPNRTHV
IITRQANYEVPEGCVVVSSLQEAIAFCPKEEEVFVIGGGQIYQQAIDLVDKIDLTRVHTT
VEADAFFPEINTQKWELVFEEFHSKDEKHNYDFTFLTYIKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgctaactataatcgctgccgcagcagaaaataatgctttagggaaagacaaccaattg
gtttggcatttacccgatgattttaaacgttttaaaagtttaacttcgggacattatatt
attatgggacgaaaaacctttgaaagttttccgaaacccctgcctaatcgcacacatgta
atcattacacgccaagctaattatgaagttcctgaaggatgtgtcgtagtttcaagctta
caagaagcaatagctttttgtcctaaagaggaagaagtgtttgttattggtggcggtcag
atctaccaacaagcgattgatttagtggataaaatcgatttaactcgcgtacatactact
gttgaggcagatgcttttttccctgaaattaatacacaaaaatgggaattggtatttgaa
gagtttcattcaaaagatgaaaaacacaattacgattttacatttttaacgtacattaaa
aaataa

DBGET integrated database retrieval system