KEGG   Flavobacterium indicum: KQS_02370Help
Entry
KQS_02370         CDS       T01781                                 

Gene name
dfrA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fin  Flavobacterium indicum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KQS_02370 (dfrA)
   00670 One carbon pool by folate
    KQS_02370 (dfrA)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KQS_02370 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564597..565082
Genome map
AA seq 161 aa AA seqDB search
MLTIIAAAAENNALGKDNQLVWHLPDDFKRFKSLTSGHYIIMGRKTFESFPKPLPNRTHV
IITRQANYEVPEGCVVVSSLQEAIAFCPKEEEVFVIGGGQIYQQAIDLVDKIDLTRVHTT
VEADAFFPEINTQKWELVFEEFHSKDEKHNYDFTFLTYIKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgctaactataatcgctgccgcagcagaaaataatgctttagggaaagacaaccaattg
gtttggcatttacccgatgattttaaacgttttaaaagtttaacttcgggacattatatt
attatgggacgaaaaacctttgaaagttttccgaaacccctgcctaatcgcacacatgta
atcattacacgccaagctaattatgaagttcctgaaggatgtgtcgtagtttcaagctta
caagaagcaatagctttttgtcctaaagaggaagaagtgtttgttattggtggcggtcag
atctaccaacaagcgattgatttagtggataaaatcgatttaactcgcgtacatactact
gttgaggcagatgcttttttccctgaaattaatacacaaaaatgggaattggtatttgaa
gagtttcattcaaaagatgaaaaacacaattacgattttacatttttaacgtacattaaa
aaataa

DBGET integrated database retrieval system