KEGG   Flavobacterium indicum: KQS_02520Help
Entry
KQS_02520         CDS       T01781                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fin  Flavobacterium indicum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KQS_02520
Enzymes [BR:fin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KQS_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598806..599492
Genome map
AA seq 228 aa AA seqDB search
MTKYPTVDTSKLVSFSIDEIGDNHLFTSVETPMKADAFLLSDDEKKDKIAFHFKEIMEVL
GLDLTDDSLKGTPQRVAKMYIDEIFCGLNPANKPHVALFENKYQYNQMLVEKNITFYSNC
EHHFVPIFGKIHVAYISKGKVIGLSKINRIVQYFAQRPQVQERLTIQIGIELQQILETED
IAVIVDAKHLCVSSRGIKDESSATVTSYYGGIFQNEQKMMELHNYLKM
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtacccaacagttgatacatcaaaattagtctctttttctattgatgaaata
ggagataaccatttatttacttctgtagaaactcccatgaaagcggatgcttttctcttg
tctgatgatgagaaaaaagataaaatcgcctttcattttaaggaaataatggaagtttta
ggactcgatttaacagatgattccttaaaagggactccacaacgtgtggccaaaatgtat
atcgatgagattttttgtggcttgaatccagcgaacaaacctcatgtggctctttttgaa
aataaataccaatacaaccaaatgcttgtagagaagaatattacgttctattctaattgc
gaacatcattttgtccctatttttggtaaaatacatgtggcgtatatttcaaaaggaaaa
gtaattgggctttcaaaaataaatcgaattgtgcaatattttgctcaacgaccacaggtt
caagaacgtcttacaatacaaattggtatagaattacaacagattttagaaacagaagac
atcgccgtaattgtcgatgcaaaacatttgtgtgtgtcttctcgaggcattaaagatgaa
agttcggctacggtaaccagttactatggaggaatatttcaaaacgagcaaaaaatgatg
gaactacataattatttgaaaatgtag

DBGET integrated database retrieval system