KEGG   Flavobacterium indicum: KQS_02975Help
Entry
KQS_02975         CDS       T01781                                 

Gene name
speB
Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
fin  Flavobacterium indicum
Pathway
fin00330  Arginine and proline metabolism
fin01100  Metabolic pathways
Module
fin_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KQS_02975 (speB)
Enzymes [BR:fin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KQS_02975 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Hydrolase UPF0489
Motif
Other DBs
NCBI-ProteinID: CCG52586
UniProt: H8XSK1
Position
681506..682585
Genome map
AA seq 359 aa AA seqDB search
MTKQQKIENFDPSQPGLADATVFGLPFTAEESEIIVVPVPWEVTVSYGAGASEGPDAILD
ASFQVDLLHQDFPELWKLGIYMDEAPEHWKKNSEKYKDLAQPIIEALENGEDVATFPVLQ
ADLDKINKVCRDLHSEVKARIQHWQNKGKKVVLLGGDHSTPLGYYEALAAVHDNFGILHL
DAHMDLRIAYEGFTYSHASIMYNTLQLPQVSKIVQVGIRDFCEQEVDVVKQSKGRVTVYT
DSDLKKAQFEGATWKQQCEDIIAQLPQKVCISFDIDGMYPWYCPNTGTPVPGGFAFEQAT
YLFNLLADSGKEIIGFDLVEVAPGEEGDWDGNVGARMLFHMCGVLAKNNKMQVGNKIQF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcaacaaaagattgaaaattttgatccttcacaacctggattggcagatgcg
actgtgtttggattgccttttactgcagaagaaagcgaaattattgtagtacctgtgcct
tgggaagtaacggtaagttatggagctggcgcatcagaagggccagatgcaattttagat
gcttcatttcaagtagatttgttacaccaagattttcccgagttatggaaattaggtatc
tatatggatgaggcgccagagcattggaaaaaaaattctgaaaaatataaagatttagca
cagcctattattgaagcacttgaaaatggcgaggatgtggctacttttcctgtattacaa
gctgatctagataagataaataaggtgtgtagagacttgcattctgaagtaaaagcaaga
attcagcattggcaaaataaagggaaaaaagtagtgttgttgggtggtgatcacagtact
ccattagggtattatgaagctttagcagcagttcacgataatttcggtatcttacattta
gacgcacatatggatttgcgtattgcatatgaagggtttacttattctcatgcttctatc
atgtataatactttacaattgccacaggtttcaaaaattgttcaagttggaattagagat
ttttgcgaacaagaagtggatgttgttaaacaatcaaaaggaagggttacagtttatacg
gattctgatttgaaaaaagctcaatttgaaggggcaacgtggaaacaacagtgtgaagac
atcattgcacaattgcctcaaaaagtatgtatttcttttgatattgacggaatgtatcca
tggtattgtccaaatactggtacgccagttccaggaggttttgcatttgaacaagctact
tatttgttcaatttattagccgattctggaaaagaaatcattggttttgatcttgtagaa
gtagctccaggggaagagggtgattgggatggtaatgtaggtgccagaatgttgtttcat
atgtgtggtgttctagccaaaaacaataaaatgcaagtgggtaataaaatccaattttaa

DBGET integrated database retrieval system