KEGG   Flavobacterium indicum: KQS_04050Help
Entry
KQS_04050         CDS       T01781                                 

Gene name
tpiA
Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fin  Flavobacterium indicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KQS_04050 (tpiA)
   01230 Biosynthesis of amino acids
    KQS_04050 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KQS_04050 (tpiA)
   00051 Fructose and mannose metabolism
    KQS_04050 (tpiA)
   00562 Inositol phosphate metabolism
    KQS_04050 (tpiA)
Enzymes [BR:fin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KQS_04050 (tpiA)
Exosome [BR:fin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KQS_04050 (tpiA)
  Exosomal proteins of bladder cancer cells
   KQS_04050 (tpiA)
  Exosomal proteins of melanoma cells
   KQS_04050 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916496..917245)
Genome map
AA seq 249 aa AA seqDB search
MRKNIVAGNWKMNKDYSQAIELINQIKAGKPNTTTEVILATPFPYLAKAVELVAGTDIKI
AAQNMHQAEGGAFTGEVAANMLTSIGVNTVILGHSERRAYFHETDALLANKVDTALKHEM
TVIFCFGEELKDRQDNNHFNIVEYQLRDGLFHIEKENWKNIVLAYEPVWAIGTGETASPE
QAQEMHAFIRNLVDKVFGNEVAENVTILYGGSVKPDNAKEIFSKPDVDGGLIGGASLQAN
DFFGIINGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatatagttgccggtaactggaaaatgaataaagattactctcaagccatt
gagttaattaatcaaatcaaagcaggtaaaccaaatacaactacagaagttattttagct
actccatttccttatttagcaaaggcagtggaattagtagcaggtactgatattaagatt
gcagctcaaaatatgcaccaagcagaaggtggtgcttttacaggagaagtagccgcaaac
atgttaaccagcattggtgtaaatactgtaattcttggacacagtgaaagaagagcctat
tttcatgaaacggatgctttattagcaaataaagtcgatacggctttaaaacatgaaatg
actgtaattttctgttttggtgaagaattaaaagaccgtcaagacaacaatcattttaat
attgttgaataccaattacgagacggcttatttcatattgaaaaagaaaattggaaaaat
atagtattagcatacgaacctgtttgggcaataggaactggagaaacagctagtcctgaa
caagcacaagaaatgcacgcttttattagaaatttagtagataaagtatttggaaatgaa
gtcgcagaaaatgtaaccattctatatggaggcagtgtaaaaccagataatgctaaagaa
attttctctaaacctgatgttgatggaggcttaattggtggagcatccttacaagcaaat
gatttctttggaattataaacggaatataa

DBGET integrated database retrieval system