KEGG   Flavobacterium indicum: KQS_04070Help
Entry
KQS_04070         CDS       T01781                                 

Gene name
folP
Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fin  Flavobacterium indicum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fin00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919584..920357
Genome map
AA seq 257 aa AA seqDB search
MGILNVTPDSFFDGGTLKNADEVVQKVEKMLDEGADFIDLGGYSSRPGAAFVSVEEELNR
VVPIVEILVEKFSDILISIDTFRSDVAQKAIEAGAAMINDISAGMLDENMIPTVAKLQVP
YIMMHMRGTPQTMQTLTDYNDIIKDINFYFSERCALARSFGLNDIIIDPGFGFAKTTEQN
FELLHKMELLQMTGLPILAGISRKSMIYKTLQTTPDKALNGTTFLHAFCLQKGASILRVH
DVKEAVECVKLISQFGN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggggattttaaatgtgactcccgattctttttttgatgggggtacgctaaaaaatgcc
gatgaagtggttcaaaaagtagaaaagatgttggatgaaggggctgattttattgactta
ggaggttattcaagtcggccaggagctgcatttgtttctgtggaagaagaattgaatagg
gtagtacccattgttgaaattttggttgaaaaattttcagatattttaatttctattgat
acttttcgaagtgatgtagctcaaaaagccatagaagcgggtgcggcgatgattaatgat
atttcagcgggaatgttagatgagaatatgattcctacagtagcaaaattgcaagttccc
tacattatgatgcatatgcgaggcacacctcaaaccatgcaaacattaacagattataac
gatattattaaagatattaatttttatttttctgaacgttgtgctttggcacgaagtttt
ggtttgaatgatatcattatcgatcctggatttggttttgctaaaacaactgaacaaaat
tttgaattattacataaaatggaattgttgcaaatgacaggattaccaattttagcagga
atatcgagaaaatcaatgatatataaaaccttgcaaactacaccggataaggcgttaaat
ggaacaacttttttgcatgccttttgtttgcaaaaaggggcttctattttacgtgttcac
gatgtgaaagaagcggtggagtgcgtgaaattaattagccaatttggcaattag

DBGET integrated database retrieval system