KEGG   Flavobacterium indicum: KQS_04455Help
Entry
KQS_04455         CDS       T01781                                 

Gene name
glsA
Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fin  Flavobacterium indicum
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KQS_04455 (glsA)
   00330 Arginine and proline metabolism
    KQS_04455 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KQS_04455 (glsA)
Enzymes [BR:fin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     KQS_04455 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002623..1003534
Genome map
AA seq 303 aa AA seqDB search
MNYRTVLDKIYINSKDFPKMGVVSTSIPELAKVHPDKFGIHLTTINGEEIGVGNSNEKFS
IQSVSKALTVALAFSKCGEEIWNRVGVEPSGNPFNSLVQLEFEKGIPRNPFINAGALVIA
DILVTVLQNPKEDLLHFIRTISGFETIDFNLKVAQSEKETGFRNAALANFLKSFGNIQNE
VDVVLDFYFHQCSIEMTCKELAHAFFIFANEGKTKKGNQILTTSQVKRLNALMQTCGFYD
ESGEFTYRVGLPGKSGIGGGIAALLPKQFAIACWSPRLNEKGNSELGMFALEQLTTETGM
SIF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcgaaccgttttagataaaatatatattaattctaaagattttcctaaaatg
ggagtggtgtcaacttctattccagaattggcaaaagtacacccagataaatttggaata
cacttaacaacaataaatggagaagaaataggtgttgggaattctaacgaaaagttttct
attcaatcggtttcaaaagcattaactgtagcactagcattttctaaatgtggtgaggaa
atatggaatcgagttggcgtagaaccttcgggaaatccatttaattccttagtgcaatta
gaatttgaaaaaggaattccaagaaatccatttattaatgccggagctttagtaattgct
gatattttagttacagtacttcaaaatcctaaagaagatttgttgcattttatcagaacc
atttccggatttgaaacgatagattttaatttaaaagttgctcaatctgaaaaagaaact
ggatttagaaatgcggcattagctaatttcctaaaatcatttggaaatattcaaaatgag
gtagatgtggtgttagatttttattttcaccaatgctctattgaaatgacctgtaaagaa
ttagcccatgcgttttttatttttgctaacgaaggaaaaacaaaaaaaggcaatcaaata
ctaacaacaagtcaagtgaaacgattaaatgctttaatgcaaacttgcggattttatgac
gaatcgggtgagtttacctatcgtgtaggattgcctggtaaaagtggaattggtggtgga
attgctgccttattgccaaaacaattcgctattgcctgttggtctcctcgattaaatgaa
aaaggaaattcagaattaggcatgtttgccttagaacaattaactaccgaaacaggtatg
tcaatattttaa

DBGET integrated database retrieval system