KEGG   Flavobacterium indicum: KQS_05475Help
Entry
KQS_05475         CDS       T01781                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fin  Flavobacterium indicum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KQS_05475
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KQS_05475
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KQS_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1206384..1206866
Genome map
AA seq 160 aa AA seqDB search
MSEDFYSFSAENIQGKTISMQDYKGKFVLIVNTASQCGLTPQYEGLEKLYLKYKDKGLVV
LGFPCNQFGGQEPGDEKSIQEGCLLNYGVSFSMFSKVDVNGSNAHPLFVYLKKKLGSFFG
NSIKWNFTKFLINPSGKPLKRFSPITKPETIDNYLSKYLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagatttttattctttttcggctgaaaatattcagggaaaaacaatctcaatg
caagattataaaggtaaatttgtattaattgtaaataccgccagtcaatgtggtttaaca
cctcagtatgaagggttagaaaaattatatttaaaatataaagataaaggacttgttgtt
ttaggatttccttgtaatcaatttggcggtcaagagcctggagatgaaaaatcgattcaa
gaaggttgtttacttaattatggtgtttctttttctatgttttcaaaagttgatgtaaat
ggttcaaatgcccatccattatttgtttatttaaagaaaaaattaggtagtttttttggc
aacagcataaaatggaattttaccaagtttttaattaatccctcgggaaaacctttaaaa
cgattttctcccattactaaacctgaaaccattgataactatttatcaaagtatttaaaa
taa

DBGET integrated database retrieval system