KEGG   Flavobacterium indicum: KQS_06655Help
Entry
KQS_06655         CDS       T01781                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fin  Flavobacterium indicum
Pathway
fin00010  Glycolysis / Gluconeogenesis
fin00030  Pentose phosphate pathway
fin00051  Fructose and mannose metabolism
fin00052  Galactose metabolism
fin00680  Methane metabolism
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01130  Biosynthesis of antibiotics
fin01200  Carbon metabolism
fin01230  Biosynthesis of amino acids
fin03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KQS_06655 (pfkA)
   00030 Pentose phosphate pathway
    KQS_06655 (pfkA)
   00051 Fructose and mannose metabolism
    KQS_06655 (pfkA)
   00052 Galactose metabolism
    KQS_06655 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KQS_06655 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KQS_06655 (pfkA)
Enzymes [BR:fin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KQS_06655 (pfkA)
Protein phosphatases and associated proteins [BR:fin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KQS_06655 (pfkA)
Messenger RNA biogenesis [BR:fin03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KQS_06655 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CCG53290
UniProt: H8XPL6
Position
1474956..1475942
Genome map
AA seq 328 aa AA seqDB search
MTSTIKKIGVLTSGGDAPGMNAAIRAVVRACAYYNVECIGIYRGYQGMIEGDFKEMGPRT
VKNIINKGGTILKSARSKDFMTTEGRLQAYNHLKESGVDALVVIGGDGTFTGAEIFNNEF
QFPIIGIPGTIDNDIYGTSHTLGYDTALNTVVEAIDKIRDTANSHNRLFFVEVMGRDAGH
IALNAGIGGGAEEILIPEENLGLDRLVESLRKSKDSGKTSSIVVVAEGDKIGKNVFELKD
YVEENMPDYDVRVSVLGHMQRGGAPSCFDRVLASRLGVKAVEVLLEGKTNYMVGLLADKV
VLTPLEQAIKGQSRVDAELVKVSDIISI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaacaatcaaaaaaataggagttttaacttctggtggagatgctccaggaatg
aatgcggctattcgtgcagtagttagagcttgtgcctattacaatgtagaatgtattggt
atttatagaggttaccaagggatgattgaaggtgacttcaaagaaatggggccgcgtaca
gtaaaaaacattattaataaaggagggactatattaaaatcagcacgttctaaagatttt
atgactacagaaggtcgtctacaagcctacaatcatttaaaagaaagtggagtagatgct
ttagtggttattggaggtgatggaacatttacaggtgcagaaatttttaataatgaattt
caatttccaattattggtataccaggaactattgataatgatatttatggtacttctcat
actttaggttacgatacggctttaaacactgttgtagaagcaattgataaaattcgtgat
acggctaattcgcataaccgactattttttgtagaagttatgggtagagatgccggacat
attgctttgaatgctggaattggaggtggagcagaagaaattttaattccagaagaaaat
ttaggactagatcgattagttgaatccttaaggaaaagtaaagattctggaaaaacatct
tccattgtagtagttgctgaaggagataaaattgggaaaaatgtttttgaattgaaagat
tatgtagaagaaaatatgcctgattatgatgttcgtgtctcagttcttggtcacatgcaa
agagggggtgctccttcttgttttgatcgtgttttagcttctagattaggtgtaaaagca
gtagaagttttactagaaggaaaaacaaattatatggtaggattattagctgataaagta
gtgttaactcctttagaacaagcaattaaaggacaatcaagagttgatgcagaactggtt
aaagtttctgatatcatctctatttaa

DBGET integrated database retrieval system