KEGG   Flavobacterium indicum: KQS_06655Help
Entry
KQS_06655         CDS       T01781                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fin  Flavobacterium indicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KQS_06655 (pfkA)
   01230 Biosynthesis of amino acids
    KQS_06655 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KQS_06655 (pfkA)
   00030 Pentose phosphate pathway
    KQS_06655 (pfkA)
   00051 Fructose and mannose metabolism
    KQS_06655 (pfkA)
   00052 Galactose metabolism
    KQS_06655 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KQS_06655 (pfkA)
Enzymes [BR:fin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KQS_06655 (pfkA)
Protein phosphatases and associated proteins [BR:fin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KQS_06655 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1474956..1475942
Genome map
AA seq 328 aa AA seqDB search
MTSTIKKIGVLTSGGDAPGMNAAIRAVVRACAYYNVECIGIYRGYQGMIEGDFKEMGPRT
VKNIINKGGTILKSARSKDFMTTEGRLQAYNHLKESGVDALVVIGGDGTFTGAEIFNNEF
QFPIIGIPGTIDNDIYGTSHTLGYDTALNTVVEAIDKIRDTANSHNRLFFVEVMGRDAGH
IALNAGIGGGAEEILIPEENLGLDRLVESLRKSKDSGKTSSIVVVAEGDKIGKNVFELKD
YVEENMPDYDVRVSVLGHMQRGGAPSCFDRVLASRLGVKAVEVLLEGKTNYMVGLLADKV
VLTPLEQAIKGQSRVDAELVKVSDIISI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaacaatcaaaaaaataggagttttaacttctggtggagatgctccaggaatg
aatgcggctattcgtgcagtagttagagcttgtgcctattacaatgtagaatgtattggt
atttatagaggttaccaagggatgattgaaggtgacttcaaagaaatggggccgcgtaca
gtaaaaaacattattaataaaggagggactatattaaaatcagcacgttctaaagatttt
atgactacagaaggtcgtctacaagcctacaatcatttaaaagaaagtggagtagatgct
ttagtggttattggaggtgatggaacatttacaggtgcagaaatttttaataatgaattt
caatttccaattattggtataccaggaactattgataatgatatttatggtacttctcat
actttaggttacgatacggctttaaacactgttgtagaagcaattgataaaattcgtgat
acggctaattcgcataaccgactattttttgtagaagttatgggtagagatgccggacat
attgctttgaatgctggaattggaggtggagcagaagaaattttaattccagaagaaaat
ttaggactagatcgattagttgaatccttaaggaaaagtaaagattctggaaaaacatct
tccattgtagtagttgctgaaggagataaaattgggaaaaatgtttttgaattgaaagat
tatgtagaagaaaatatgcctgattatgatgttcgtgtctcagttcttggtcacatgcaa
agagggggtgctccttcttgttttgatcgtgttttagcttctagattaggtgtaaaagca
gtagaagttttactagaaggaaaaacaaattatatggtaggattattagctgataaagta
gtgttaactcctttagaacaagcaattaaaggacaatcaagagttgatgcagaactggtt
aaagtttctgatatcatctctatttaa

DBGET integrated database retrieval system