KEGG   Flavobacterium indicum: KQS_06900Help
Entry
KQS_06900         CDS       T01781                                 

Gene name
acsA
Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fin  Flavobacterium indicum
Pathway
fin00010  Glycolysis / Gluconeogenesis
fin00620  Pyruvate metabolism
fin00640  Propanoate metabolism
fin00680  Methane metabolism
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01130  Biosynthesis of antibiotics
fin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KQS_06900 (acsA)
   00620 Pyruvate metabolism
    KQS_06900 (acsA)
   00640 Propanoate metabolism
    KQS_06900 (acsA)
  Energy metabolism
   00680 Methane metabolism
    KQS_06900 (acsA)
Enzymes [BR:fin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KQS_06900 (acsA)
Lipid biosynthesis proteins [BR:fin01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KQS_06900 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCG53339
UniProt: H8XQP1
Position
1520376..1522283
Genome map
AA seq 635 aa AA seqDB search
MSYYKVKDLENYFKMYKKSVREPRKFWDRIADENFVWYQRWDKVFEYDMQEAQFKWFLNA
KVNITKNCIDRHLAKRGDKTAIIFEPNNPSEAAQHISYNELYVRVSKMANVLRDLGIKKG
DRVCIYLPMIPDLAIAVLACARIGAIHSVVFAGFSAGALEARITDSDCKMVITSDGAYRG
DKTINLKSIVDEALEKCPSVEKVLVVKRTNENVSMKDGRDIWAQPLLDAAMDNNVAEIMD
AEDPLFILYTSGSTGKPKGMVHTTAGYMVYTAYTFKNVFNYEENDVYWCTADIGWITGHS
YILYGPLLNGATTVIFEGVPSYPDFSRFWEVIEKHQVNQFYTAPTAIRALAKESIDYVQK
FPLSSLKVIGSVGEPINEEAWHWYNDHVGGKRCPLVDTWWQTETGGIMVSPLPFITPTKP
TYASLPLPGIQPVLMDELRNEIEGNQVTGSLCIKFPWPSIARTIWGDHQRYIDTYFKAFP
GKYFTGDGALRDEVGYYRITGRVDDVIIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHD
IKGNALYGYVILKESGEYRNHDNLRKEINQLISDQVGPIAKLDKIQFVNGLPKTRSGKIM
RRILRKIAEGDFSNFGDTSTLLNPEIVDEIKEGKI
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagttactataaagttaaggatttagaaaattactttaaaatgtataaaaaatcagta
agagaacctagaaaattctgggatcgaattgctgatgaaaactttgtttggtatcaaaga
tgggataaagtttttgaatacgatatgcaagaagctcaatttaaatggtttctaaacgca
aaagttaatattactaaaaactgtattgatagacatttagctaaaagaggggataaaaca
gctataatttttgaaccaaataatccaagtgaagcagcacaacatatttcatataatgaa
ttgtatgttcgtgtttcaaaaatggcaaatgttctgagagatttaggaataaaaaaaggt
gatagagtttgtatttatttaccaatgatacccgatttagctattgctgtattagcatgt
gctcgaattggtgccattcactctgttgtttttgcaggtttctcagctggtgctttagag
gctagaattacggatagtgattgtaaaatggtcattacatcggacggtgcttatcgtgga
gataaaacaataaatttaaaaagtattgttgatgaagcacttgaaaaatgtccttctgta
gaaaaagttttagtggttaagcgtacaaatgaaaatgtttctatgaaagacggacgagat
atttgggcgcaaccgttattagatgctgcaatggataataatgttgcagaaattatggat
gctgaagacccgctgtttattttatatacttcgggttctacaggtaaaccaaaaggaatg
gttcatacaaccgctggatacatggtttatacagcgtatacatttaaaaatgtatttaat
tatgaagagaatgatgtgtattggtgtacagctgatatcggttggattactggccattca
tatattctttatggaccgcttttaaatggggctacaactgtaatttttgaaggagttcca
tcatatcctgattttagtagattttgggaagtaattgaaaaacatcaagttaatcaattt
tatacagcaccaactgctattcgtgcattagctaaagaaagtattgattatgtacaaaaa
ttccctttaagttctttaaaagtgattggttctgtaggtgagccaattaatgaagaagca
tggcactggtataacgaccatgtaggagggaagcgatgtcctttagtagacacttggtgg
caaacagaaactggtggtataatggtttcaccactgccgtttatcacacctacaaaacct
acttatgcatcattacctttacctggaattcaacctgttttaatggacgaattgcgaaat
gaaattgaaggtaatcaagttacgggtagtttgtgtattaaattcccatggccgtctatt
gctagaaccatttggggcgatcatcaaagatatattgacacctattttaaagcttttcca
ggaaaatattttacaggtgatggagctttaagagatgaagttggttattatagaattaca
ggaagagttgatgatgtaatcattgtatcaggacataatttaggaactgcaccaattgaa
gatgcaataaatgaacaccctgctgttgctgaaagtgcgattgttggattcccacatgat
attaaaggaaatgccttatacggttatgttattttaaaagaaagtggggaataccgtaat
cacgataacttaagaaaagaaattaatcaactaatttctgatcaagtaggccctattgct
aaattagataaaattcagtttgttaacggtttaccaaaaactcgttctggaaaaatcatg
agaagaattttaagaaaaatagctgaaggtgatttctctaactttggagatacatctacg
cttcttaatccagaaattgttgacgaaattaaagaaggtaaaatttag

DBGET integrated database retrieval system