KEGG   Flavobacterium indicum: KQS_06985Help
Entry
KQS_06985         CDS       T01781                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
fin  Flavobacterium indicum
Pathway
fin00340  Histidine metabolism
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01230  Biosynthesis of amino acids
Module
fin_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    KQS_06985 (hisD)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     KQS_06985 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh LRS4
Motif
Other DBs
NCBI-ProteinID: CCG53356
UniProt: H8XQQ8
Position
complement(1535313..1536596)
Genome map
AA seq 427 aa AA seqDB search
MKVYLNPSQNDWSELLKRPTDSIADLQNTVTDIFKEVQQKGDKAVDKYTSFFDGVILNSI
EVTSVEIQEAIEQVPIELKEAIQLAQSNIEKFHQAQKTEKVAVETAKGVICWQEKRPIQK
IGLYIPGGSAPLFSTVLMLAIPAKLAGCKEIVLCSPPNKEGKINPAILYAAQLCGVTKIF
KVGGIQAIAALTFGTKTIPQVSKIFGPGNQYVTVAKQIATNYGIAIDMPAGPSELLVLAD
ETANASYIASDLLSQAEHGADSQVVLVTTDSNLISAVQQEIELQIKKLPRKSIAEKAILN
SRFIYFKDKESAMEFVNEYAPEHLIIVSKEEDFYLDNLQNAGSVFLGNYTPESAGDYASG
TNHTLPTNGYAKNYSGVNLDSFMKAMTFQKISKEGIQNIGKAIEIMAEAEGLQAHKNAVT
LRLKDLV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttatctaaacccaagtcaaaatgattggtctgaattacttaaaagaccaaca
gattcaatagctgatttacaaaatacagttacggatatttttaaagaagttcaacaaaaa
ggtgataaagcagtagataagtacacctctttttttgatggtgtaattttaaattcaatt
gaagtaacgagtgttgaaattcaagaagctattgaacaagtacccattgaattaaaagaa
gcaattcaattagcccagtcaaatattgaaaaatttcaccaggcacaaaaaacagaaaag
gttgcagttgaaaccgctaagggtgtaatttgttggcaagaaaaaagacctattcagaaa
attggattgtatattcctggaggttcggcgcctttattttcaaccgttttaatgttagcg
attccagctaaattggcggggtgtaaagagattgtattgtgttctcctcctaacaaagaa
ggcaaaatcaatccggctattttatatgcggctcaattatgtggcgtgactaaaattttt
aaggttggaggcattcaagcaatagcggcattgacatttggaacaaaaacaattcctcaa
gtatctaaaatatttggaccaggaaatcaatatgtaacagtagcgaaacaaatagcaacc
aattacggtatcgctattgatatgccagctggtccgtctgagttattggttttagctgat
gaaacggcaaatgcttcttatattgcttcagatttattgagtcaggctgaacatggtgcg
gatagtcaggtggttttagtaactactgattcaaatttaatttcagctgttcaacaagaa
attgagctacaaattaaaaagttaccccgtaaatctatagctgaaaaagcaattttgaat
tcccgctttatttatttcaaagataaagaatcggctatggaatttgtgaatgaatatgct
cctgaacacttaattattgtttcaaaagaggaagatttttatttagataatttgcaaaat
gctggttcagtatttcttggtaattatactccagaaagtgcaggagattatgcttcaggt
acaaatcatacattacctacgaatggctatgctaaaaattatagtggtgtaaatctagat
agttttatgaaagccatgacgtttcaaaaaatttcaaaagaaggcatacaaaatattggt
aaagccatagaaataatggcagaagctgaagggcttcaagcgcacaaaaatgccgtaaca
ttgcgattaaaagatttagtatga

DBGET integrated database retrieval system