KEGG   Flavobacterium indicum: KQS_07015Help
Entry
KQS_07015         CDS       T01781                                 

Definition
cytochrome c peroxidase precursor (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fin  Flavobacterium indicum
Brite
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     KQS_07015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543373..1544575
Genome map
AA seq 400 aa AA seqDB search
MKKLTNLLGLICCIAFISCNNDDDYESIPSSSYSNSYPNVVATFGTNLDLDHLYNYANQT
IPSYITKDNSAGNSINDKIATLGRVLFYDKNLSSNNSISCASCHKQEFAFGDNVVASTGV
NGTTGRHSMRLVNSRFATETHFFWDERALTLEQQTTMPIKDHGEMGFSGLNGDLSFNDLL
VKLSAKNYYKELFQFAYGNQEITEIKIQTALAQFIRSIQSFDSKYDTGRALAPNDGVPFS
NFTQQENQGKNLFLTPPTFNASGSRTGGGLGCAGCHRAPEFDIDPNSKNNGIIGTIAGTG
IDVTNTKAPSLRNLVRNDGTLNGQLMHTGVITSLQAAIGHYGTITIAPGNTNLDPRLTPN
GVGQQLNLTQNEVDAVIAFLRTLSGTDVYTNAKWSNPFPN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaacaaatctcttaggattgatatgttgtattgcatttattagttgcaat
aatgatgacgattacgaatcaattccatcttcatcatattctaattcttatcccaatgta
gtagcaacttttggtactaatttagacttagatcatttgtacaattatgcaaatcaaacg
attccaagctatataacaaaagataattctgctggaaatagcattaatgataaaatagct
accttaggaagagttttattttacgacaaaaatttatcttctaacaattctatttcttgt
gcttcatgtcataaacaagagtttgcatttggagataatgtggtagcaagtacaggagtc
aatggtactacaggaagacattctatgcgattagtaaattctagatttgctacagaaact
cattttttttgggatgaaagagctttaactttagaacaacaaacaactatgcctattaaa
gatcatggagaaatgggctttagtggtttaaatggtgatttgtcttttaatgatttatta
gtaaagttaagtgctaaaaattattacaaagaattattccaatttgcttatggcaatcaa
gaaattacagaaattaaaattcaaactgcacttgctcaatttattagaagtatacaatca
tttgactccaaatatgatacaggaagagctttagcgccaaatgatggtgtacctttttct
aatttcacacaacaagaaaatcagggtaaaaatctttttttaaccccaccaacatttaat
gcaagtggatcaagaactggcggaggcttaggttgtgctggatgtcatagagcaccagaa
tttgacattgatccaaattcaaaaaataatggcattattggtacaattgctggtacagga
atagatgtaaccaatacaaaagcaccatctcttagaaatttagttagaaatgacggtact
ttaaatggacaactcatgcatactggagtcattacaagtttacaagctgcgattggtcat
tatggcacaattacaattgccccgggaaataccaatttagatccaagattaacaccaaac
ggagtaggtcaacaattaaatttaacacagaatgaagtagatgcggtaattgctttctta
agaacactctcaggaactgacgtttataccaatgcaaagtggagcaatccatttccaaat
taa

DBGET integrated database retrieval system