KEGG   Flavobacterium indicum: KQS_07255Help
Entry
KQS_07255         CDS       T01781                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fin  Flavobacterium indicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KQS_07255 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KQS_07255 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KQS_07255 (trpA)
Enzymes [BR:fin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KQS_07255 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1588265..1589026)
Genome map
AA seq 253 aa AA seqDB search
MNRINLKLEEDKKIRSIYFTAGYPSLNDTVSIIKELEQSGVDMIEIGLPFSDPLADGPVI
QESSSKAIENGMTTKLLFEQLKNIRDEVQIPLLIMGYFNPIMQFGVEQFCKKCHEIGIDG
LIIPDLPVEIFEEHYKLLFEKYGLKNIFLITPQTTDKRILQIDQLSDSFIYMVSTAAITG
GSSEFGKQQTEYFKRIHSMQLKNPQIIGFGIKDKQTFNQALQFQKGAIIGSEFIKFLKEN
SIVRIHTFVNCFC
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaataaatttgaaattagaagaagataaaaaaatacgatcgatttattttaca
gcaggttaccctagtttaaatgatacagtgtcaattattaaagaattagagcaatctgga
gtagatatgattgaaattggacttccgttttccgatcctttagcggatggacccgttatt
caagagagttcttccaaggcaattgaaaatggaatgaccacaaagttattatttgaacaa
ttaaaaaacattcgtgatgaagttcaaattccgctattaataatggggtattttaatccg
attatgcaatttggtgtagagcaattttgtaaaaaatgccatgaaattggaattgacggt
ttaattatccccgatttacctgtggaaatctttgaagaacattataagttactctttgaa
aaatacggattaaaaaacatatttttaattacacctcaaacaacagacaaaaggattctt
caaatagatcaattatcggatagttttatttatatggtaagtacagcagctattactggt
ggttcttcagaatttggaaaacaacaaacggagtattttaaacgtattcattccatgcaa
cttaaaaaccctcaaataattgggtttggaattaaagataaacaaaccttcaaccaagcc
cttcaatttcaaaaaggcgccattataggcagtgaatttataaaatttctaaaagaaaat
tcaatcgtccgaattcatacgttcgtcaattgtttttgttaa

DBGET integrated database retrieval system