KEGG   Flavobacterium indicum: KQS_07255Help
Entry
KQS_07255         CDS       T01781                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fin  Flavobacterium indicum
Pathway
fin00260  Glycine, serine and threonine metabolism
fin00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01130  Biosynthesis of antibiotics
fin01230  Biosynthesis of amino acids
Module
fin_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KQS_07255 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KQS_07255 (trpA)
Enzymes [BR:fin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KQS_07255 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA YjcQ HMGL-like
Motif
Other DBs
NCBI-ProteinID: CCG53409
UniProt: H8XQW1
Position
complement(1588265..1589026)
Genome map
AA seq 253 aa AA seqDB search
MNRINLKLEEDKKIRSIYFTAGYPSLNDTVSIIKELEQSGVDMIEIGLPFSDPLADGPVI
QESSSKAIENGMTTKLLFEQLKNIRDEVQIPLLIMGYFNPIMQFGVEQFCKKCHEIGIDG
LIIPDLPVEIFEEHYKLLFEKYGLKNIFLITPQTTDKRILQIDQLSDSFIYMVSTAAITG
GSSEFGKQQTEYFKRIHSMQLKNPQIIGFGIKDKQTFNQALQFQKGAIIGSEFIKFLKEN
SIVRIHTFVNCFC
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaataaatttgaaattagaagaagataaaaaaatacgatcgatttattttaca
gcaggttaccctagtttaaatgatacagtgtcaattattaaagaattagagcaatctgga
gtagatatgattgaaattggacttccgttttccgatcctttagcggatggacccgttatt
caagagagttcttccaaggcaattgaaaatggaatgaccacaaagttattatttgaacaa
ttaaaaaacattcgtgatgaagttcaaattccgctattaataatggggtattttaatccg
attatgcaatttggtgtagagcaattttgtaaaaaatgccatgaaattggaattgacggt
ttaattatccccgatttacctgtggaaatctttgaagaacattataagttactctttgaa
aaatacggattaaaaaacatatttttaattacacctcaaacaacagacaaaaggattctt
caaatagatcaattatcggatagttttatttatatggtaagtacagcagctattactggt
ggttcttcagaatttggaaaacaacaaacggagtattttaaacgtattcattccatgcaa
cttaaaaaccctcaaataattgggtttggaattaaagataaacaaaccttcaaccaagcc
cttcaatttcaaaaaggcgccattataggcagtgaatttataaaatttctaaaagaaaat
tcaatcgtccgaattcatacgttcgtcaattgtttttgttaa

DBGET integrated database retrieval system