KEGG   Flavobacterium indicum: KQS_09500Help
Entry
KQS_09500         CDS       T01781                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fin  Flavobacterium indicum
Pathway
fin00230  Purine metabolism
fin01100  Metabolic pathways
Module
fin_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KQS_09500 (gmk)
Enzymes [BR:fin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KQS_09500 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 RsgA_GTPase cobW AAA_16 AAA_24 ABC_tran Herpes_BLRF2 AAA AAA_19 TsaE
Motif
Other DBs
NCBI-ProteinID: CCG53833
UniProt: H8XUQ5
Position
complement(2030090..2030665)
Genome map
AA seq 191 aa AA seqDB search
MTKGKLLVFSAPSGSGKTTIVKHLLSKEDLNLEFSISCTTRAPRGEEVHGKDYYFISWEE
FKKHIKAEEFVEWEEVYTDNFYGTLKAEVERIWAKGKHVIFDIDVAGGLRIKSKFPNETL
AVFVKPPSVDELKRRLKQRSTESEDKINMRIAKASVELATAPQFDTIIKNYDLDVAKEEA
YKLVKDFISEK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggaaaattattagtattctcagctccatcaggttcagggaaaaccactata
gttaaacatttattaagtaaagaagatttaaatttagaattttcaatttcatgtaccact
cgagcaccaagaggtgaagaagttcacggaaaagattattattttatttcttgggaagag
tttaaaaaacacatcaaagcggaggaatttgtagaatgggaagaagtgtataccgataat
ttttacggaactttaaaagctgaagtagaacgtatttgggctaaaggaaaacatgtgatt
tttgatattgatgtggcgggtggtttgcgtataaaaagcaaatttccgaatgaaacctta
gccgtttttgttaaaccaccaagtgtagacgaattaaagcgtcgtttgaaacaacgttca
actgaaagtgaagacaaaatcaatatgcgtattgctaaggcatcggtagaattagccact
gcaccacaatttgataccatcatcaaaaactatgatttagatgtggctaaagaagaagca
tacaaattggtaaaggattttatttctgaaaagtaa

DBGET integrated database retrieval system