KEGG   Flavobacterium indicum: KQS_09770Help
Entry
KQS_09770         CDS       T01781                                 

Gene name
aceB
Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fin  Flavobacterium indicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KQS_09770 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KQS_09770 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    KQS_09770 (aceB)
Enzymes [BR:fin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KQS_09770 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2087859..2089439
Genome map
AA seq 526 aa AA seqDB search
MKTQSTQLTVLNQNKFSTILTEEALAFLTALHTNFNSKRIELVKKRETKQALYDSGAFPS
FPKETEALRNEDWTAAPIPAILLDRRVEITGPVDRKMVINALNSGAKIFMADFEDSCSPT
WNNVMEGQENIKDAVNKSIRLEQNGKTYQLNSETATLLVRPRGLHLEEKNLQVEEEKMSG
ALVDFGLFFYHNAHSLLKQGLGPYFYLPKLESYEEARWWNEVFIYAQNYCNIPVGTIKAT
VLIETITASFQLDEIIYELKEHIAGLNCGRWDYIFSYIKKLKSHPDFIVPDRDQITMTSP
FMSAYSLRVIQVCHKRNILAIGGMAAQIPIKNNEEANQTAFDKVKADKEREVKNGHDGTW
VAHPALVPLAMQVFNENMPTKNQLHIKRNEIQITEKQLLELPIGSITEIGIRKNINVGIL
YMESWLMGVGAAALYHLMEDAATAEISRAQLWLWLKKQVKTDKGTEITKELYQKYIPEEL
EKIKNYVGLKRFEEGKFELATSLFSTLIMKDELDDFLTLEAYNYID
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaatcaacacaacttacagttttaaatcaaaataaattttctacaatccta
acagaagaagcgttagcatttttaactgcattacataccaactttaatagcaaaaggatt
gaattagtaaaaaaaagagagacaaaacaagctttatatgatagtggtgcttttccatct
tttcctaaagaaactgaagccttaagaaatgaagattggacagcagctcctattccagca
atattattagatagaagagttgaaattacagggccagttgatcgaaaaatggtaatcaat
gcattaaattcaggagctaaaatttttatggctgattttgaagatagttgttcgcccact
tggaacaatgtaatggaaggacaagaaaatataaaagatgctgtaaataaaagtatacga
ttagaacaaaatggcaaaacttatcaattaaactctgaaaccgctaccttattagttcga
ccgagaggtttgcatttggaagagaaaaatttacaagttgaagaagaaaaaatgtcgggc
gcattagtggatttcggattgtttttttatcacaacgcgcattccttactcaaacaagga
ttaggtccttatttctatttaccaaaactagaatcttatgaagaagcgcgttggtggaat
gaagtgtttatttatgcacagaactattgtaatattccggttggaacgataaaagcaacc
gtattaattgaaacgataaccgcaagttttcaattagatgaaataatttacgaattaaaa
gaacatattgccggattgaattgtggtcgttgggattatattttttcctatatcaaaaaa
ttaaaatcacaccccgatttcatagttcctgatcgtgatcaaattaccatgacaagccct
ttcatgagcgcctattctttaagggtcattcaagtttgtcataaaaggaatattcttgct
atcggcggaatggctgcacaaattccgattaaaaataacgaagaagcaaatcaaactgca
tttgataaagtgaaagccgataaagaacgagaagtgaaaaacggccatgacggcacttgg
gttgcacatcctgccttggttcctttagctatgcaggtatttaatgaaaatatgccaact
aaaaaccaattacatattaaaagaaatgaaattcaaattacagaaaaacagttattagaa
ttaccaattggttcaatcactgaaattggaattagaaaaaacatcaatgttggaatatta
tatatggaatcatggctaatgggtgttggagcggcagccttatatcatttaatggaagat
gctgcaaccgcagaaatttcaagagcacaattatggctttggttaaaaaaacaagtaaaa
acagataagggtactgaaattacaaaagaattatatcaaaaatatattccagaagaattg
gaaaaaataaaaaactatgtaggacttaaacgttttgaagaaggcaaatttgaattagcc
acctcacttttttcaaccttgatcatgaaggacgaattagatgattttttaacactggaa
gcctacaactatattgattaa

DBGET integrated database retrieval system