KEGG   Flavobacterium indicum: KQS_09775Help
Entry
KQS_09775         CDS       T01781                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
fin  Flavobacterium indicum
Pathway
fin00630  Glyoxylate and dicarboxylate metabolism
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01200  Carbon metabolism
Module
fin_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KQS_09775 (aceA)
Enzymes [BR:fin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KQS_09775 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCG53886
UniProt: H8XUV8
Position
2089523..2090800
Genome map
AA seq 425 aa AA seqDB search
MKTQDRIQALISDWTTNPRWKGIERPYTAEKVVELQGSYQIEYSIAKRGAEILWNKLNNQ
DWVAGLGALTGNQAIQEVEAGLEAIYLSGWQVAADANLAGEMYPDQSLYPANSVPQVVKR
INNALLRADQIQSVNKVENKKDYLVPIVADAEAGFGGNLNAFELMKGMIEAGAAGVHFED
QLSSAKKCGHLGGKVLVPTQEAINKLIAARLAADTMGVPTIIVARTDADAANLLTSDIDD
RDKEFVTGERSPEGFFYVKAGLEQGISRGLSYAPYADLIWLETSTPDLEEARKFAEAIHA
KFPGKLLAYNCSPSFNWAAKLSVEQMETFREDIAKMGYKFQFITLAGFHALNTSMFELAL
AYKRKGMAGYSELQQKEFALQAEGFRAVKHQNFVGTTYFDEVQNAVTAGLASTVAMKDST
ETAQF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacaagacagaattcaagcattaatttcagattggaccacaaatcctagatgg
aaaggaatcgaaagaccttatactgctgaaaaagtagtagaacttcagggttcctaccaa
atcgaatattctattgcaaaaagaggcgctgaaattttatggaataaattaaataaccaa
gattgggtggctggtttaggtgctttaacaggtaatcaagccatacaagaagttgaagcc
ggtttagaagcgatttatttaagtggatggcaagtagccgcagatgctaatttagcagga
gaaatgtaccctgatcaatcgttatatcctgccaatagtgtacctcaagttgtaaaaaga
atcaacaatgccttattaagagcagaccaaattcagtcggtaaataaagttgaaaacaaa
aaagattatttagtaccaatagtagcagatgcagaagcaggatttggaggcaatctaaat
gcttttgaattaatgaaaggcatgattgaagcaggtgcggctggcgttcactttgaagac
caattgtcgtctgcaaaaaaatgtgggcatttaggaggaaaagtattggtacctacacaa
gaggctattaataaattaattgctgcacgtttagccgctgacaccatgggagttcctacc
ataattgtagcacgaacagatgctgatgcagccaacttattaactagtgatatcgacgat
agagacaaagaatttgttacaggagagcgctctccagaaggctttttctatgtaaaagca
ggattagaacaaggcatttcaagaggattatcttatgcgccttatgctgatttaatttgg
ttagaaacatctactccagacctagaagaagctagaaaatttgcagaagccattcatgct
aaatttcccggaaaattattagcttataactgctccccttcatttaattgggctgcaaaa
ttgagcgtagaacaaatggaaactttccgtgaggatattgccaaaatgggatataaattc
caatttattactttggctggattccacgctttaaatacttccatgtttgaattagcattg
gcttataaaagaaaaggaatggcgggatactctgaattacagcaaaaagaatttgcgctt
caagctgaaggattccgcgctgtaaaacaccaaaattttgtaggcactacttattttgat
gaagtacaaaatgcagttactgctggtttagcatcaactgtagcaatgaaagattctact
gaaactgcacagttttaa

DBGET integrated database retrieval system