KEGG   Flavobacterium indicum: KQS_10060Help
Entry
KQS_10060         CDS       T01781                                 

Gene name
bsaA
Definition
Glutathione peroxidase BsaA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fin  Flavobacterium indicum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fin00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fin00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2146083..2146688)
Genome map
AA seq 201 aa AA seqDB search
MKLSYLIPFPILAFLACTQVNKDAQVSEINHSTSITKDKVMEKETIYSFKVKDLAGDAFD
FASLKGKKIMIVNTASECGLTPQYEQLQSVYEEYKDKNFVIVGFPANNFGAQEPGSNAEI
ATFCKKNYGVTFPMMSKISVKGQDMHPIYQFLTQKAKNGLQDSEVQWNFQKYLIDENGHL
AKVISPRTLPNDKEIINWIKG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcctatttaatcccttttccaattttagctttcttagcgtgtacacaagta
aataaggatgcccaagtgtctgaaatcaatcattcaacaagtataacaaaagataaagtc
atggaaaaagaaacaatttattcttttaaagtaaaagatttagcaggtgatgcgtttgac
tttgcttctttaaaaggaaaaaaaatcatgatagtaaacaccgcttctgaatgtggatta
actccccagtacgagcaattacaatcggtttacgaagaatacaaagacaagaattttgtc
atagttggttttcctgcgaataattttggtgcacaagaacctggttcaaatgctgaaatt
gctacattttgtaaaaagaattatggggttacattcccgatgatgtctaaaatttcagtt
aaaggtcaggacatgcacccaatttaccagtttttgactcaaaaagctaaaaatggttta
caagacagtgaagtgcaatggaattttcaaaaatatttaattgatgaaaatggacattta
gctaaagtgatttcgccaagaactttacctaatgataaagaaattataaattggattaaa
ggttaa

DBGET integrated database retrieval system