KEGG   Flavobacterium indicum: KQS_10060Help
Entry
KQS_10060         CDS       T01781                                 

Gene name
bsaA
Definition
Glutathione peroxidase BsaA (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fin  Flavobacterium indicum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KQS_10060 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KQS_10060 (bsaA)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KQS_10060 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2146083..2146688)
Genome map
AA seq 201 aa AA seqDB search
MKLSYLIPFPILAFLACTQVNKDAQVSEINHSTSITKDKVMEKETIYSFKVKDLAGDAFD
FASLKGKKIMIVNTASECGLTPQYEQLQSVYEEYKDKNFVIVGFPANNFGAQEPGSNAEI
ATFCKKNYGVTFPMMSKISVKGQDMHPIYQFLTQKAKNGLQDSEVQWNFQKYLIDENGHL
AKVISPRTLPNDKEIINWIKG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcctatttaatcccttttccaattttagctttcttagcgtgtacacaagta
aataaggatgcccaagtgtctgaaatcaatcattcaacaagtataacaaaagataaagtc
atggaaaaagaaacaatttattcttttaaagtaaaagatttagcaggtgatgcgtttgac
tttgcttctttaaaaggaaaaaaaatcatgatagtaaacaccgcttctgaatgtggatta
actccccagtacgagcaattacaatcggtttacgaagaatacaaagacaagaattttgtc
atagttggttttcctgcgaataattttggtgcacaagaacctggttcaaatgctgaaatt
gctacattttgtaaaaagaattatggggttacattcccgatgatgtctaaaatttcagtt
aaaggtcaggacatgcacccaatttaccagtttttgactcaaaaagctaaaaatggttta
caagacagtgaagtgcaatggaattttcaaaaatatttaattgatgaaaatggacattta
gctaaagtgatttcgccaagaactttacctaatgataaagaaattataaattggattaaa
ggttaa

DBGET integrated database retrieval system