KEGG   Flavobacterium indicum: KQS_10180Help
Entry
KQS_10180         CDS       T01781                                 

Gene name
bfmBB
Definition
Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fin  Flavobacterium indicum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KQS_10180 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KQS_10180 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    KQS_10180 (bfmBB)
Enzymes [BR:fin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KQS_10180 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2166680..2167990)
Genome map
AA seq 436 aa AA seqDB search
MAKFELKLPKMGESVAEATITNWLKNVGDTIEMDEAVLEIATDKVDSEVPSEVAGTLVEI
LFNVDDVVQVGQTIAIIETDGGAVEAAPVAKTEAPVAVAEVVKTVEAAKEVATPADFSSS
DKFFSPLVKNIAKEEGISLAELEAIPGTGKDGRVNKEDILNYIKTRGNQPVATATPVVEA
SKAAPVAASSSTQAVPVSVNGGDEIVEMDRMRKLISKYMVESKQTSAHVQSFIEVDVTNI
VKWRDKNKNAFEKREGEKLTFTPIFMEAVAKALKEFPGMNISVEGEYIIKKKNINLGMAA
ALPNGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNVGTFGSV
FGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALGGSFV
KRVADLLESWDINREI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtttgaattaaagcttccgaaaatgggagaaagtgttgcggaagcaactatt
acaaattggttaaaaaatgtaggggatacgattgaaatggacgaagctgtccttgaaatc
gcaacagataaagtagatagtgaagtaccttctgaagtagctgggactttagttgaaatt
ttatttaatgttgatgatgttgttcaagttggacaaaccattgctattattgaaacggat
ggcggagcagtagaagctgcaccagtggctaaaactgaagcaccggttgctgtagcagaa
gtagttaaaactgttgaggcagctaaagaagtagccactccagcagatttttcaagttca
gataaattcttttctcctttagttaaaaatattgctaaagaagaaggtatttcattggct
gaattagaagcaattccaggaactggaaaagacggaagagtgaataaagaagatatctta
aattatatcaaaactagaggaaatcaacctgtagctactgcaacgccagtagttgaggct
tcaaaagctgcacctgtagcggcatcttcttctacacaagcagtaccagtttcggtaaat
ggtggtgatgagattgttgaaatggacagaatgcgtaagttgatttcaaaatacatggtg
gaatctaaacaaacttcggctcacgtacaatctttcattgaagtggatgttaccaatatt
gtaaaatggagagataaaaataaaaatgcatttgaaaagagagaaggtgaaaaattaact
tttacaccaatcttcatggaagcagtagcaaaagcattgaaagaattcccaggaatgaat
atttcggttgaaggcgagtacattattaaaaagaaaaatatcaatttaggaatggctgcg
gcattacctaacggaaatttaattgtacctgtaattaaaaatgcagatcaattgaattta
gtaggtatggcgaaggcggttaatgatttaggaaaccgtgctaaagcgggtaaattaaaa
ccagacgatacacaaggcggaacgtatacagtgactaacgtaggtacttttgggtctgtt
tttggaacaccaattattaaccaaccacaagtaggtattttagccctaggtgctatcaga
aaagtaccagcggttattgaaactccagaaggagatttcattggaattcgtcaaaaaatg
ttcttatctcactcgtatgatcatagagtggttgatggtgcactaggaggtagttttgta
aaacgcgtggcagatttattagagtcttgggacatcaatagagaaatttaa

DBGET integrated database retrieval system