KEGG   Flavobacterium indicum: KQS_13195Help
Entry
KQS_13195         CDS       T01781                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fin  Flavobacterium indicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KQS_13195
Enzymes [BR:fin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KQS_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2804834..2805592
Genome map
AA seq 252 aa AA seqDB search
MSNLKVKTILVSQPEPKVENSPYFDLQNKWKVKVDFRPFIHVEGVPAKEVRAQKIDLNNF
SAIIFTSKNSVDHFFRVAEEMRYKVPEDLKYFCQSEAIAYYLQKYVVYRKRRIYVGQKEF
TDLAPLIKKYKDEKFLLPNTDQLNADVPQTLENLKVDWKQGIFYRTVMSDLSDLKDVYYD
VLAFFSPTGIKSLFKNFPDFQQNNTRIAVFGETTKKEALEHGLRVDIMAPAPGTPSMTGA
LEKYVSETNKGK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttgaaagtgaaaactattttggtttcacaaccagaaccaaaggtggaaaat
tcaccttatttcgacctacagaataaatggaaagtaaaagttgattttagaccatttatc
catgtagaaggcgttcctgcaaaagaagttagagcacagaaaatcgatttaaataatttt
tctgccattatttttacaagtaaaaattcagtagatcacttttttagagttgctgaagaa
atgcgttataaagtgccagaagatttaaaatatttttgtcaatctgaagctattgcttac
tatctgcaaaaatatgttgtgtacagaaaaagaagaatttatgtgggccaaaaagaattt
actgatttagccccattaattaaaaaatacaaagacgaaaaattcttgttacccaatacc
gaccagttaaatgctgatgttccacaaacattagaaaatttaaaagttgattggaaacaa
ggtattttttaccgaacagtaatgagcgatttatccgatttaaaagacgtttattatgat
gttttagcattttttagtccgactggaattaaatctttatttaagaactttcctgatttt
caacaaaacaatacacgtattgctgtatttggtgaaactactaaaaaagaagctttggaa
catggattacgtgtagacattatggctcctgctccgggaactccatcaatgactggagca
ttagaaaaatatgtttctgaaacaaataaaggaaaataa

DBGET integrated database retrieval system