KEGG   Flavobacterium johnsoniae UW101: Fjoh_0333Help
Entry
Fjoh_0333         CDS       T00508                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00521  Streptomycin biosynthesis
fjo00523  Polyketide sugar unit biosynthesis
fjo01130  Biosynthesis of antibiotics
Module
fjo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Fjoh_0333
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fjoh_0333
Enzymes [BR:fjo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Fjoh_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABQ03369
JGI: Fjoh0333
UniProt: A5FN48
Position
complement(354544..355092)
Genome map
AA seq 182 aa AA seqDB search
MKIEKTFIKDLLIVEPTIFGDERGYFFESYSKTKFEDLDIHIDFVQDNQSFSKRGTLRGL
HYQNPPFAQTKLVRVLEGEIIDVAVDLRKDSATYGKVFSVLLSSENKKQLLVPQGFAHGF
SVISETASVMYKCDQFYNKASEGGIRFDDSSLNIDWGMDLKDAIVSEKDQKLPFLDNCNS
LF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaaaaaacgtttataaaagatttattaattgtagaaccaacaatatttgga
gatgaaagaggatatttttttgaatcttacagtaaaactaaatttgaagatctagatatt
catattgatttcgttcaagacaatcaatcattctcaaaaagaggaactttaagaggtttg
cattatcaaaatcctccgtttgcacaaaccaagttagtacgagttctagaaggtgaaatt
attgacgttgctgtagatttaagaaaagattcagcaacttatggaaaagtatttagtgtt
ttgttgtcatctgaaaataaaaaacagttattagtgccacaagggtttgctcatggattt
tcagttatcagcgagactgcttcggtaatgtataaatgtgatcagttttataataaagct
tcagaaggaggaattagatttgatgactcatctttaaatattgattggggaatggattta
aaagatgcaattgtttctgaaaaagatcaaaaactaccttttcttgataattgtaatagt
ttattctaa

DBGET integrated database retrieval system