KEGG   Flavobacterium johnsoniae UW101: Fjoh_1652Help
Entry
Fjoh_1652         CDS       T00508                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fjoh_1652
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Fjoh_1652
DNA repair and recombination proteins [BR:fjo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Fjoh_1652
    RecFOR pathway proteins
     Fjoh_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1917094..1917675
Genome map
AA seq 193 aa AA seqDB search
MIAHLQGKLVEKNPTEVVIDCGGVGYHVNISLHTFSLIPNADFIKLYTHLQIKEDAHTLY
GFVEKSEREIFRMLLSVSGIGAGIARTMLSSIEPRQIINAIASGDVGVIQSIKGIGNKTA
QRVILDLKEKVLKLYDLDEVSVVQNNTNRDEALSALEVLGFVRKTSEKVVEKIVKEDPEA
TVETIIKKALKSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacatttgcagggaaaattagtcgaaaagaatcccacagaagttgtaattgat
tgcggaggagtgggataccacgtaaatatttcgttacatactttttcattaattccaaat
gctgattttataaaattgtatacgcatcttcaaatcaaagaagatgcgcatactttatat
ggttttgtagaaaagtctgaacgtgagatatttagaatgctgttatctgtttcaggaatt
ggagccggcatcgcacgaacaatgctttcgtctatagaacccagacaaattattaatgcc
attgcctcaggagatgttggagttatccagtctataaaaggtattggaaacaaaacagca
cagcgagtaatacttgatttaaaagaaaaagtgttaaagttgtacgatttagacgaagtt
tctgttgtccaaaacaatacaaatcgagatgaagcgttatctgctttggaagttttagga
ttcgttcgtaaaacatctgaaaaagtagtggaaaaaatcgtcaaagaagatccggaagct
actgttgaaacgatcatcaaaaaggccttaaaaagcttataa

DBGET integrated database retrieval system