KEGG   Flavobacterium johnsoniae: Fjoh_1738Help
Entry
Fjoh_1738         CDS       T00508                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fjoh_1738
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fjoh_1738
   00630 Glyoxylate and dicarboxylate metabolism
    Fjoh_1738
Enzymes [BR:fjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fjoh_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2011042..2012664
Genome map
AA seq 540 aa AA seqDB search
MKLKTTAMKNQLEITETAMEFLAEKKLRYPKIWTEEAIVFITELHRKFESQRKLLLLQRE
QKQVTFDQGIMPVFIPETKSVREGSWKAGEIPKDLLDRRVEITGPVDRKMIINALNSGAK
TFMADFEDSTSPTWQNLMDGQVNLIDAVNKTITFTDLVKQKSYHLNEKIATLIVRPRGLH
LPEKHVLVEGNEVSGSLIDFGLYVFHNHKRLLENNSGPYFYIPKLEHYLEARWWNNVIDF
TEDYLKLNRGTIKVTVLIETITASFQLDEIIYELKEHIVGLNCGRWDYIFSYIKKFRKNP
KFIVPDRDQVTMTSPFMSAYSNLVIQRCHKRGIHAIGGMAAQIPIRNNEEANAVAFAKVR
TDKEREVKNGHDGTWVAHPDLVAIAKEIFDKGMPTPNQIHVKREHRKITEADLIEPPIGI
ITENGVRKNINVGVLYLASWLNGQGAAALHNLMEDAATAEISRSQLWQWLQNKVILDNGR
KLDLAYYHELALNEFRKIKEEIGEENYEKQQFPLAEKMLERLVVNLHFVDFVTLPCYKYL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaccacagctatgaaaaaccaattagaaattaccgaaacggcaatggaa
tttttagccgaaaagaagcttcgttatccaaagatctggacagaagaagccattgttttt
ataactgaattgcatagaaaattcgaatcacagcgaaaactattgcttttacagcgcgaa
cagaaacaagtcacttttgatcagggaattatgcctgtttttattccagaaaccaaaagt
gtgagagaaggcagttggaaagctggagaaattccgaaagatttattggatcgaagagta
gaaattaccgggccggttgaccgcaaaatgattattaatgctttgaattctggcgccaaa
acatttatggccgattttgaagacagcacttcgccaacctggcaaaacttgatggacgga
caggtaaatttgattgatgcggtaaacaaaaccattacgtttactgatttggtaaaacag
aaatcgtatcatttaaatgaaaaaatcgcaacgttaattgtacgtccgagaggtttgcat
ttgccagaaaaacatgttttagttgaaggaaatgaagtttcgggttctttgatagatttt
ggtttgtatgtttttcacaatcataaacgacttttagaaaacaattctggaccgtatttc
tacattccgaaattagagcattatctggaagcgcgctggtggaataatgtaattgatttt
accgaggattatttaaaactgaacagaggaacgataaaagtgacggttttaattgaaacg
ataacggcaagttttcaattggatgaaattatctacgaattgaaagaacatatcgttggc
ttaaactgcggacgctgggattatattttctcctacatcaaaaagtttagaaaaaatcca
aaattcatcgtgccagatcgggatcaggtaactatgacttcgccttttatgagtgcttat
tcaaatctggtaattcaaagatgtcataaaagaggaattcatgcaattggcggaatggct
gcacagattccgattcgaaataacgaagaagctaatgcagttgctttcgcaaaagtaaga
accgataaggaacgtgaagttaaaaatggacacgacggaacttgggtagcgcatccggat
ttagttgcaatagcaaaagaaatttttgataaaggaatgccaactccaaatcagattcac
gtaaaaagagaacatcgaaaaattacagaagccgatttgattgaaccgccaattggaatc
attactgaaaatggtgtccgcaaaaacatcaacgttggagttttatatctggcttcatgg
ctaaacggacaaggcgccgccgctttacataatttgatggaagatgctgcaacggccgaa
atttcgagatcacaattgtggcaatggcttcagaataaagtgattttagataatggacga
aaattagatttggcttattatcatgaattggctttaaatgaattcagaaaaatcaaggaa
gaaataggagaagaaaattatgaaaaacaacaatttccattagccgaaaaaatgctggaa
agactggttgtaaacctgcattttgtggatttcgttactcttccatgttataaatatcta
taa

DBGET integrated database retrieval system