KEGG   Flavobacterium johnsoniae: Fjoh_1738Help
Entry
Fjoh_1738         CDS       T00508                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fjoh_1738
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fjoh_1738
   00630 Glyoxylate and dicarboxylate metabolism
    Fjoh_1738
Enzymes [BR:fjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fjoh_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2011042..2012664
Genome map
AA seq 540 aa AA seqDB search
MKLKTTAMKNQLEITETAMEFLAEKKLRYPKIWTEEAIVFITELHRKFESQRKLLLLQRE
QKQVTFDQGIMPVFIPETKSVREGSWKAGEIPKDLLDRRVEITGPVDRKMIINALNSGAK
TFMADFEDSTSPTWQNLMDGQVNLIDAVNKTITFTDLVKQKSYHLNEKIATLIVRPRGLH
LPEKHVLVEGNEVSGSLIDFGLYVFHNHKRLLENNSGPYFYIPKLEHYLEARWWNNVIDF
TEDYLKLNRGTIKVTVLIETITASFQLDEIIYELKEHIVGLNCGRWDYIFSYIKKFRKNP
KFIVPDRDQVTMTSPFMSAYSNLVIQRCHKRGIHAIGGMAAQIPIRNNEEANAVAFAKVR
TDKEREVKNGHDGTWVAHPDLVAIAKEIFDKGMPTPNQIHVKREHRKITEADLIEPPIGI
ITENGVRKNINVGVLYLASWLNGQGAAALHNLMEDAATAEISRSQLWQWLQNKVILDNGR
KLDLAYYHELALNEFRKIKEEIGEENYEKQQFPLAEKMLERLVVNLHFVDFVTLPCYKYL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaaccacagctatgaaaaaccaattagaaattaccgaaacggcaatggaa
tttttagccgaaaagaagcttcgttatccaaagatctggacagaagaagccattgttttt
ataactgaattgcatagaaaattcgaatcacagcgaaaactattgcttttacagcgcgaa
cagaaacaagtcacttttgatcagggaattatgcctgtttttattccagaaaccaaaagt
gtgagagaaggcagttggaaagctggagaaattccgaaagatttattggatcgaagagta
gaaattaccgggccggttgaccgcaaaatgattattaatgctttgaattctggcgccaaa
acatttatggccgattttgaagacagcacttcgccaacctggcaaaacttgatggacgga
caggtaaatttgattgatgcggtaaacaaaaccattacgtttactgatttggtaaaacag
aaatcgtatcatttaaatgaaaaaatcgcaacgttaattgtacgtccgagaggtttgcat
ttgccagaaaaacatgttttagttgaaggaaatgaagtttcgggttctttgatagatttt
ggtttgtatgtttttcacaatcataaacgacttttagaaaacaattctggaccgtatttc
tacattccgaaattagagcattatctggaagcgcgctggtggaataatgtaattgatttt
accgaggattatttaaaactgaacagaggaacgataaaagtgacggttttaattgaaacg
ataacggcaagttttcaattggatgaaattatctacgaattgaaagaacatatcgttggc
ttaaactgcggacgctgggattatattttctcctacatcaaaaagtttagaaaaaatcca
aaattcatcgtgccagatcgggatcaggtaactatgacttcgccttttatgagtgcttat
tcaaatctggtaattcaaagatgtcataaaagaggaattcatgcaattggcggaatggct
gcacagattccgattcgaaataacgaagaagctaatgcagttgctttcgcaaaagtaaga
accgataaggaacgtgaagttaaaaatggacacgacggaacttgggtagcgcatccggat
ttagttgcaatagcaaaagaaatttttgataaaggaatgccaactccaaatcagattcac
gtaaaaagagaacatcgaaaaattacagaagccgatttgattgaaccgccaattggaatc
attactgaaaatggtgtccgcaaaaacatcaacgttggagttttatatctggcttcatgg
ctaaacggacaaggcgccgccgctttacataatttgatggaagatgctgcaacggccgaa
atttcgagatcacaattgtggcaatggcttcagaataaagtgattttagataatggacga
aaattagatttggcttattatcatgaattggctttaaatgaattcagaaaaatcaaggaa
gaaataggagaagaaaattatgaaaaacaacaatttccattagccgaaaaaatgctggaa
agactggttgtaaacctgcattttgtggatttcgttactcttccatgttataaatatcta
taa

DBGET integrated database retrieval system